CAZyme Information: ASPNIDRAFT2_1118127-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1118127-t41_1-p1
• CAZy Family: CE12
• CAZyme Description: Glucooligosaccharide oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496		53501.41	4.5774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000004.1:3621576-3623126(+)

Full Sequence      

MLSTMAFSFVLRILSPLFLILQLSTAASTSTLRQCLLTAVQNDPTLVAVDGDLLYQTLAV
QVYNLNWPVTPAAVAFPKSTQQVASIVNCAASLGYKVQAKSGGHSYGNYGLGGTNGAISI
NLKNMKSFSMNYTNYQATVGAGMLNGELDEYLHNAGGRAVAHGTSPQIGVGGHATIGGLG
PSARQYGMELDHVLEAEVVLANGTVVRASSTQNSDLLFAIKGAGASFGVVTEFVFRTEPE
PGSAVQYTFTFGLGSTSARADLFKKWQSFISQPDLTRKFASICTLLDHVLVISGTFFGTK
EEYDALGLEDQFLGHTNSTVIVFTDWLGLVAQWAEQSILDLTGGIPADFYARCLSFTEKT
LIPSNGVDQLFEYLDSADTGALLWFVIFDLEGGAINDVPMDATGYAHRDTLFWLQSYAIT
LGSVSETTYDFLDNVNEIIRNNTPGLGNGVYPGYVDPRLQNAREAYWGSNLPRLMQIKSL
YDPTDLFHNPQGVLPA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	61	272	7.2e-69	0.4497816593886463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	4.34e-30	71	209	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.65e-29	67	493	28	456	FAD/FMN-containing dehydrogenase [Energy production and conversion].
178402	PLN02805	1.08e-12	71	245	134	312	D-lactate dehydrogenase [cytochrome]
369658	BBE	3.76e-12	450	493	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	4.44e-12	12	231	3	232	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17347.1|AA7	7.77e-188	28	493	5	471
QMW42271.1|AA7	3.19e-177	33	496	10	474
QMW30198.1|AA7	9.09e-177	33	496	10	474
QRD86662.1|AA7	1.24e-176	33	496	19	483
UDD61931.1|AA7	3.67e-176	33	496	10	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	6.21e-64	63	496	53	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3HSU_A	1.12e-60	63	495	35	478	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	2.18e-60	63	495	35	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6Y0R_AAA	4.65e-60	63	495	53	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
3RJ8_A	4.40e-59	60	496	26	472	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	1.51e-113	28	495	3	469	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	3.20e-63	63	496	53	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	1.03e-59	63	495	54	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	2.39e-59	63	495	53	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	3.68e-58	60	496	48	494	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002275	0.997706	CS pos: 26-27. Pr: 0.9830

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1118127-t41_1-p1.