CAZyme Information: ASPNIDRAFT2_1116774-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1116774-t41_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: Glycoside Hydrolase Family 74 / Carbohydrate-Binding Module Family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	ACJE01000004.1|CGC16	89685.38	4.0918

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000004.1:573765-576594(+)

Full Sequence      

MRRTFAALVAGYLLDSVHAAASQAYTWKNVVTGGGGGFTPGIVFNPSAKGVAYARTDIGG
AYRLNSDDTWTPLMDWANNSNWHDWGIDAIATDPVDTDRVYVAVGMYTNDWDPNDGSILR
STDQGDTWEETKLPFKVGGNMPGRGVGERLAVDPNDNSILYFGARSGNGLWKSTDYGETW
SNVTAFKWTGTYFQDSSSTYTSDPVGIAWVTFDSTSGSSGSPTPRIFVGVVDTGESVFVS
EDAGETWTWVSGEPMYGFLPHKGILSPSEHTLYISYSNGAGPYDGTNGTVHKYNITSGVW
TDISPTSMTDTYYGYGGLAVDLQVPGTVMVAALNCWWPDELIWRSTDSGATWSPIWAWNG
YPSINYYYSYDISNAPWLQDDTSTDEFPVRVGWMVEALAIDPFDSDHWLYGTGETIYGGH
DLQNWDSEHNVTIESLAVGIEEMAVLGLITPPGGPALLSAVGDDGGFYHTSLTTAPSQYY
HTPTYSSTNGIDYAGNKPANIVRSGSSDSDPTLALSSSFGESWYADYAASSSTATGQVAL
SADADTILLMNSDGAYRSANSATLSAVSSLPSGAVIASDKANNTYFYGASGSSFYLSSDT
AATFTVTTTLGSSTTANAIRAHPSLAGDVWVSTDTGLFHSTNYGKSFTQIGSGCTEGWSF
GFGKPSSDGDYPVLFGFFTVDGVTGLFKTEDQGVNWQIISDAEHGFGSASANVVNGDLQN
YGRVFVGTNGRGIFYGDPSGTLPSATATASSASSTAVKSSTSTSTSKVGSSTTVSSSTAT
TITTSSIKSTTLTTTTKSSSSTTSTSSTATGTASAYGQCGGSGFTGPTQCPSGWTCTYEN
EYYSQCLEG

Enzyme Prediction     

EC	3.2.1.151:27	3.2.1.150:4	-	3.2.1.151:27	3.2.1.150:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH74	73	185	7.8e-26	0.4678111587982833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	1.07e-13	815	847	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.99e-12	815	843	1	29	Fungal cellulose binding domain.
214740	VPS10	4.97e-08	116	279	55	253	VPS10 domain.
406353	Sortilin-Vps10	1.31e-07	87	200	25	133	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
271234	Sialidase_non-viral	1.26e-04	43	248	95	294	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK77227.1|CBM1|GH74|3.2.1.151	0.0	1	846	1	846
CAK43558.1|CBM1|GH74	0.0	1	845	1	845
BCS07982.1|CBM1|GH74	0.0	106	849	1	746
BCR95437.1|CBM1|GH74	0.0	106	849	1	746
QGA17431.1|CBM1|GH74	0.0	13	846	16	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGL_A	1.41e-231	22	738	3	746	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, D60A mutant in complex with XXLG and XGXXLG xyloglucan [Paenibacillus odorifer]
6MGJ_A	8.27e-228	22	738	3	746	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_E Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_F Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_G Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_H Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGK_A Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer]
6P2N_A	2.75e-226	20	738	1	747	Crystal structure of Paenibacillus graminis GH74 (PgGH74) [Paenibacillus graminis]
4LGN_A	1.17e-222	20	740	2	737	The structure of Acidothermus cellulolyticus family 74 glycoside hydrolase [Acidothermus cellulolyticus 11B]
2CN3_A	1.10e-208	16	743	2	736	Chain A, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus],2CN3_B Chain B, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Z9M8|XG74_HYPJQ	3.18e-269	21	847	17	838	Xyloglucanase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cel74a PE=1 SV=1
sp|Q3MUH7|XG74_PAESP	5.38e-239	13	740	26	768	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
sp|A3DFA0|XG74_ACET2	6.52e-209	5	746	14	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xghA PE=3 SV=1
sp|Q70DK5|XG74_ACETH	2.60e-208	5	746	14	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus OX=1515 GN=xghA PE=1 SV=1
sp|Q8J0D2|CBHRE_GEOS1	8.20e-88	7	737	10	784	Oligoxyloglucan reducing end-specific cellobiohydrolase OS=Geotrichum sp. (strain M128) OX=203496 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000333	0.999654	CS pos: 19-20. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1116774-t41_1-p1.