CAZyme Information: ASPNIDRAFT2_1116622-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1116622-t41_1-p1
• CAZy Family: CBM63
• CAZyme Description: Glycoside Hydrolase Family 51 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628	ACJE01000004.1|CGC7	67832.78	3.8786

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000004.1:103565-105803(+)

Full Sequence      

MVAFSALSGVSAVSLLLSLVQNAHGISLKVSTQGGNSSSPILYGFMFEDINHSGDGGIYG
QMLQNPGLQGTAPNLTAWAAVGDATIAIDGDSPLTSAIPSTIKLNIADDATGAVGLTNEG
YWGIPVDGSEFHSSFWIKGDYSGDITVRLVGNYTGTEYGSTTITHTSTADNFTQASVKFP
TTKAPDGNVLYELTVDGSVAAGSSLNFGYLTLFGETYKSRENGLKPQLANVLDDMKGSFL
RFPGGNNLEGNSAENRWKWNETIGDLCDRPGREGTWTYYNTDGLGLHEYFYWCEDLGLVP
VLGVWDGFALESGGNTPLTGDALTPYIDDVLNELEYILGDTSTTYGAWRAANGQEEPWNL
TMVEIGNEDMLGGGCESYAERFTAFYDAIHAAYPDLILIASTSEADCLPESMPEGSWVDY
HDYSTPDGLVGQFNYFDNLNRSVPYFIGEYSRWEIDWPNMKGSVAEAVFMIGFERNSDVV
KMAAYAPLLQLINSTQWTPDLIGYTQSPGDIFLSTSYYVQEMFSRNRGDTIKEVTSDSDF
GPLYWVASSAGDSYYVKLANYGSETQDLTVSIPGTSTGKLTVLADSDPDAYNSDTQTLVT
PSESTVQASNGTFTFSLPAWAVAVLAAN

Enzyme Prediction     

EC	3.2.1.55:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	214	450	4.5e-53	0.3682539682539683
GH51	432	626	1.1e-51	0.38095238095238093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214830	Alpha-L-AF_C	4.48e-46	452	620	12	188	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
399741	Alpha-L-AF_C	1.51e-36	458	620	22	191	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
226064	AbfA	8.08e-31	212	625	38	496	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAC41644.1|GH51|3.2.1.55	0.0	1	628	1	628
CAA01904.1|GH51|3.2.1.55	0.0	1	628	1	628
ADG21260.1|GH51|3.2.1.55	0.0	1	628	1	628
AAE37582.1|GH51|3.2.1.55	0.0	1	628	1	628
CAK43424.1|GH51|3.2.1.55	0.0	1	628	1	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	1.09e-138	26	625	1	622	Chain AAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
2Y2W_A	1.53e-10	221	417	89	266	Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_B Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_C Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_D Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_E Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_F Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U790|ABFA_ASPOR	0.0	1	628	1	629	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2
sp|P42254|ABFA_ASPNG	0.0	1	628	1	628	Alpha-L-arabinofuranosidase A OS=Aspergillus niger OX=5061 GN=abfA PE=1 SV=1
sp|Q0CTV2|ABFA_ASPTN	0.0	1	628	1	628	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
sp|A2Q7E0|ABFA_ASPNC	0.0	1	628	1	628	Probable alpha-L-arabinofuranosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=abfA PE=3 SV=1
sp|Q8NK90|ABFA_ASPKW	0.0	1	628	1	628	Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=abfA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999760	CS pos: 25-26. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1116622-t41_1-p1.