CAZyme Information: ASPNIDRAFT2_1095320-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1095320-t41_1-p1
• CAZy Family: GT90
• CAZyme Description: Carbohydrate-Binding Module Family 50 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	ACJE01000019.1|CGC9	46093.21	3.6705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000019.1:1525031-1526581(-)

Full Sequence      

MVSSLFLTLATFASAYALAVNKRFDNGDFPTGDTDPNVTSACTYWANSISSTDTCADLES
YYGITSTQLTSWNPSLSTTSCALQEGWSYCVSAPAVSTTASSTSTVSTVSSSLLSTTTAA
PAPGTTTGAGSPSPTQGGLSSSCDAFYYVEAGDSCWAIVNSYGNFTLNQFYSWNPAVKSD
CSGLQPDYYVCIGVAGDTTVASQTTLPATTTASAATSTGSYLPEQTGIASNCDKYYYVQH
GDTCSDIATNHDISLNDFYSWNPAVGTTCSDLEADYWVCVGVSGGATATTTTSTSTSTST
VSSTTPTSNAPSPTQSGLVGDCSTYYEAKSGDSCWFIVNDKYTYLTTSLFEEWNPAVGSD
CSNLQPGYYYCVATQKQAPMPDTIDTCKKWHLVADGDNCWSIEQDAGVTASQFNMWNPYV
GSSCANLWLGYWVCVGV

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1095320-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	5.51e-11	124	417	310	576	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	2.23e-09	234	269	1	36	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	8.70e-07	389	433	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.03e-06	146	190	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	7.00e-06	325	372	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS04737.1|CBM50	4.20e-244	1	437	1	437
CAK40753.1|CBM50	1.05e-212	1	437	1	383
BCS16307.1|CBM50	4.46e-149	1	284	1	284
UKZ53591.1|CBM50	3.79e-82	30	437	23	437
UKZ79391.1|CBM50	7.76e-78	58	437	37	424

PDB Hits     

ASPNIDRAFT2_1095320-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	1.00e-50	6	436	8	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.33e-15	223	437	251	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B4P8|LYSM2_ARTBC	5.03e-15	53	203	39	190	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	2.71e-14	143	282	268	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	1.31e-13	225	282	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000877	0.999101	CS pos: 17-18. Pr: 0.9422

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1095320-t41_1-p1.