CAZyme Information: ASPNIDRAFT2_1093210-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1093210-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: Carbohydrate Esterase Family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		37350.79	4.7922

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000015.1:35618-36746(+)

Full Sequence      

MYAWNVERFTNLVVFGDSWSDAGRLHYFISHNGSVPPVGWIDDGDTPAADGGRPWPSYVG
MYTGAEVYNYAVAGAVCSNDLTPRIAQPTGKLFPDVAGYQVPAYLADRQYTYTNGTKFMD
APPESTVYAIMIGGNDVGAAGYLTDSQTIGTTIADYIDCVFQQIDRLFQHGARNFVIHTL
GPMYLTPQYAMPNEGGLKATQYWPDKYSNISGVSQRMLEQVALVNAVYKARLPLEVGFQK
KYPGAQFALVDLDSLVSNIHKQPSAYLNGTSPYNVTGYINHCSLSGTNCFLYDYDDRDAF
MWYDELHPSEQTWRGYASIFVDIINGRSKWATYISA

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1093210-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	12	316	7.8e-57	0.9775280898876404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.28e-38	11	322	1	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.84e-11	14	322	5	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	7.77e-10	9	324	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	2.08e-09	5	308	25	317	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	0.001	12	188	1	143	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO14737.1|CE16	1.25e-112	4	333	43	370
SMR54462.1|CE16	4.51e-110	4	336	35	370
SMQ51055.1|CE16	3.05e-109	4	336	51	386
QRD06747.1|CE16	1.14e-107	4	333	28	357
QMW44554.1|CE16	7.57e-107	4	333	26	352

PDB Hits     

ASPNIDRAFT2_1093210-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	2.15e-72	7	333	25	344	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|O80470|GDL38_ARATH	7.82e-07	14	310	51	358	GDSL esterase/lipase At2g23540 OS=Arabidopsis thaliana OX=3702 GN=At2g23540 PE=2 SV=1
sp|G2QJ27|AES1_MYCTT	6.04e-06	12	208	34	220	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1093210-t41_1-p1.