CAZyme Information: ASPNIDRAFT2_1091317-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1091317-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: Glycosyltransferase Family 34 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		29837.83	4.6931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000013.1:577573-578420(-)

Full Sequence      

MVYGNKTAYYRGIKTHEEHARKFGYPMTVLHKPILGGFWSKPAILLSTLIEEMEKPEEDR
AQWLFWFDGDTVIMNSNIPLDVFLPPPQFPDTHLLIAKDWNGMNNGAFFIRVIQWSVEFL
SATLAYPAVHPDIVLFWADQSAMAKLNSENEHFSRSIIFCPLRWFNAYMRSPNAVDINPD
SPAHLQVQPGDLLVHFPGTDAEALDSTMEPYLEVAESHNPVWELPLHKTGYLKEAADFWR
DKYEEMFGESFDLSPTGNQS

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1091317-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	9	201	2e-29	0.8739837398373984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	2.87e-14	13	198	30	231	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	4.87e-07	19	122	163	264	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	1.05e-06	25	132	170	275	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96623.1|GT34	5.42e-149	1	258	1	246
QKX54237.1|GT34	3.80e-100	1	239	44	284
QKX62037.1|GT34	1.07e-99	1	240	307	548
BCS22806.1|GT34	2.48e-97	1	239	121	359
BCS22997.1|GT34	7.38e-96	1	241	69	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	1.76e-06	19	122	70	171	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09174|GMA12_SCHPO	1.88e-09	13	198	128	332	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q2R2W8|GT6_ORYSJ	3.18e-08	4	151	168	332	Probable glycosyltransferase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=GT6 PE=2 SV=1
sp|Q6Z5M3|GT7_ORYSJ	5.50e-08	28	132	164	264	Probable glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=GT7 PE=2 SV=1
sp|A2X933|GT7_ORYSI	5.50e-08	28	132	164	264	Probable glycosyltransferase 7 OS=Oryza sativa subsp. indica OX=39946 GN=GT7 PE=3 SV=2
sp|A2ZF66|GT6_ORYSI	1.85e-07	11	151	175	332	Probable glycosyltransferase 6 OS=Oryza sativa subsp. indica OX=39946 GN=GT6 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1091317-t41_1-p1.