CAZyme Information: ASPNIDRAFT2_1084751-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1084751-t41_1-p1
• CAZy Family: PL27
• CAZyme Description: Glycosyltransferase Family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		46217.85	6.8681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000005.1:70316-71761(-)

Full Sequence      

MIWRYLLRRPMLGTLCILVLFTWLLQQPDTSVKEIYLLQHRYPLLFERVHTNTRSGGAWY
IPPTWTNKTSQPPENIVDAAEQVLRLVQETPQRQIPHSLIPLIIHQTWKDTRVDTWPHVL
QQSTEKWLRTGDGQMAYFLWDDDGIRQFIRRFEPEREKQFYALPSHVEQSDVFRILVSKW
IGGVYADIDTEPLQSPASWITAADIAPWQDHETGRVYNFTGPVRAIVGLEADCPPDSDAY
WRMGYLLPVQLTQWAFAWAPGHPILQIFLDRLFTEVRGVSDQRTPAPQSQSSDLGALDPI
TLTGPVAFTHAVQSWLKAIVGLRWNALSSLQDGGKILVEENMEIWAPSPSRTLLRACSIA
RKDHGENLICGSSMASSVERCLAGVGPGPKCPRVSYFDGHRLSKQC

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1084751-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.08e-18	97	273	79	244	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.84e-10	117	200	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44893.1|GT32	1.81e-314	1	406	1	406
ADK37855.1|GT32	3.32e-139	7	335	6	335
CAK38082.1|GT32	2.27e-136	38	335	37	336
BCR93027.1|GT32	5.24e-135	7	335	6	336
BCS05686.1|GT32	5.24e-135	7	335	6	336

PDB Hits     

ASPNIDRAFT2_1084751-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	8.56e-15	88	317	129	335	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	2.87e-13	97	272	127	284	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	4.52e-08	98	200	55	159	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.02e-06	99	189	81	167	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000008

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1084751-t41_1-p1.