CAZyme Information: ASPGLDRAFT_82929-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_82929-t33_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		58401.62	8.7328

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878899:779359-780986(-)

Full Sequence      

MAQQRRILVVVAGGGYTNAAPLLKLSSILATRGYIIDFATLAGRRQWLSNSPFISRLHIV
GPAIPKEQEEESYEQMSQWATDLICNWGAVFAAKKYLESSWPHVYHNLTQLVLDPATRPD
FILADYLVDAVRDVCFEHDVPFAMHWPQMPTGMMHASYIPGIPGLQVEVLTSEFATLWQR
LKNAVRIYTALPHFLEYQRWVKQMRQSAGVSRQLPMLPRPDYLCLVNSFFALEAAKETPP
NVAAIGPVLADKVDELTEPFPSFLQSRSRVLYIALGTHVLFPHRVLADLLSGAITALRAS
LIDGIIWAASPKARRQLDTSALLPSPTDSSDETTLGSLLENKHSSILTADFAPQRPILHD
PRVAVFISHAGASSTNEAVVAGIPVITLPAYFDQIQNAMRLRDAGVSVPLQKETLSASDV
TAAVTRILNDIRNDGPIMANVRRVCGIARIAAHRKHLAVDLIEEVLVDWQGRQRERRLGV
KQPRGMHLETAEARMPRWKARNWDLFALMALPGLLVAAVVMARFF

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_82929-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	165	455	6.7e-30	0.6230366492146597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	6.46e-40	6	469	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	9.50e-19	6	466	3	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	8.23e-15	107	458	94	432	UDP-glucosyl transferase
223071	egt	7.24e-13	344	432	346	434	ecdysteroid UDP-glucosyltransferase; Provisional
177813	PLN02152	2.71e-12	225	415	201	401	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86180.1|GT1	0.0	1	525	1	525
QKD56593.1|GT1	2.37e-141	5	506	8	500
CAK46937.1|GT1	2.95e-130	5	507	11	487
CZS76244.1|GT1	9.04e-130	4	519	9	515
CEF72977.1|GT1	9.04e-130	4	519	9	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNT_A	1.48e-10	361	468	332	434	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
2O6L_A	5.90e-10	353	430	77	154	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
2IYA_A	2.41e-09	54	468	37	422	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
7CJX_A	3.43e-09	353	430	78	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6IPB_A	5.33e-09	353	430	99	176	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36513|UDB14_RABIT	2.82e-14	98	459	125	479	UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B14 PE=2 SV=1
sp|Q8JZZ0|UD3A2_MOUSE	6.48e-14	223	440	246	440	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2
sp|Q1LZI1|UD3A1_BOVIN	1.14e-13	157	432	182	432	UDP-glucuronosyltransferase 3A1 OS=Bos taurus OX=9913 GN=UGT3A1 PE=2 SV=1
sp|P36512|UDB13_RABIT	1.16e-13	153	459	190	480	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1
sp|Q9GLD9|UDB33_MACMU	2.70e-13	117	457	143	476	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

Start	End
7	29
505	524