CAZyme Information: ASPGLDRAFT_78157-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_78157-t33_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		47931.39	5.6839

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878934:12129-13573(-)

Full Sequence      

MIFNILSCLYLLVLTSHALQPKYSTWMLESIISRSEGINPADGLLGVIQKGLFQESLHAV
IQRSTDAAQIAKWSAYHRQSVDTNIGDLLNASASSRHLSLDRLCIGRSILEAHLDTPLHR
QTLKSLRRSLDLQYRNENSGFWYFVDPPPPYEAYGNLSYSDGMYAFAPFATLYGFIYGDE
STNLDTALRQLQLLYENSVQASTGLILHGYDASRGAPWADPMTGASPILWGRSLAWYMIG
VVDTLEIVDRLSPSKDRKIKMEEVFQGILDIFQRLAHGTVRMILDSTRVTGRYAIWQVMD
RPGEPGNFVEASASAMISFALAKGVRLGYLSGETGHQELFLQNDVQLKEHFWGAKVMSVA
RALYQDVLDHFVVEDEENGSLQFHGTSIIASLHEEKLDYEYYTHRAVMTNSLIGTSAFVL
SSLEMEH

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_78157-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	426	2.2e-45	0.9427710843373494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.96e-32	109	426	90	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.56e-29	81	426	58	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE47860.1|GH105	5.88e-169	6	400	82	496
UJO17900.1|GH105	8.95e-73	27	426	37	396
SMQ49260.1|GH105	3.09e-70	27	426	37	422
QDS73972.1|GH105	2.32e-69	31	426	1	352
QRC92053.1|GH105	4.52e-69	22	426	29	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	8.52e-33	22	426	3	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.57e-25	61	426	50	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.69e-24	61	426	40	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	2.87e-24	61	426	50	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	9.48e-19	168	333	4	150	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	9.48e-19	168	333	4	150	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999709	CS pos: 18-19. Pr: 0.9810

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_78157-t33_1-p1.