CAZyme Information: ASPGLDRAFT_77756-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_77756-t33_1-p1
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	KV878920|CGC2	62371.92	5.6155

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878920:187329-188998(-)

Full Sequence      

MVDEAQRSFEAVKSRQSRSLPEAVAEYKRRYGLPPPPHFDKWYEFAVARGTVLVDEFDTI
YHNLLPFWALEPKTIRSRTREDLGYDNRLVGISIRQGKSDNRGEGQGNFQSTAIQAMVSS
FAHLLPDMDLAFNIHDEPRVVVPHDSLDKMVTLGREVQSRLLLNEQDLKNQFSKTPGQLD
EDIANNPRTRFHDIGMQETWLFSRLSCPLDSPARQLNGGAPDNPDILGDASLGLISNHTA
FSDICQTPSLQYRLGFFDKPNACKLSPELTPVFSMSKLSSFQDILYPSPWYYTDQIYFDK
DKAVDWDQHITQLYWRGATSGGFSDKGTWRQQLRQYLVDELTHSHSNTTELILSQKRPGP
EECNIWEESWDLKEAHVKSNELFNIKFTEVKQCSTTDCDEEDAYFDTARREKQSEAWKYR
YLLDMDGNAYSGRFYAFLQSYAVIMKLSFFREWHENILFPWVHYVPLSLKTIGYAEILRF
FEQDTKGQTAAKRIADSGRNWAHTTLRHEDMEVYMFRLLLEYGRLVDDNRESLGYHK

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_77756-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	247	526	6.5e-73	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.39e-21	258	525	13	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.34e-08	399	525	196	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85771.1|GT90	0.0	1	536	94	631
BCS23432.1|GT90	1.05e-201	1	535	83	622
CAP94138.1|GT90	9.75e-196	4	535	94	620
QQK42027.1|GT90	1.50e-191	4	534	99	626
CAP97161.1|GT90	3.28e-188	1	522	101	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	7.93e-08	238	529	85	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	8.72e-07	271	526	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.59e-48	1	532	157	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	9.40e-10	238	526	128	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	3.73e-08	268	526	160	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	4.59e-07	238	529	113	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q8BYB9|PGLT1_MOUSE	1.42e-06	238	529	113	373	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_77756-t33_1-p1.