CAZyme Information: ASPGLDRAFT_67299-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_67299-t33_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	KV878900|CGC4	40864.42	4.7081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878900:179040-180168(-)

Full Sequence      

MPTFRKSLIAAIFLVACILVLRSSHSSSSFSSSSITDIPPITPDEIVNEESLPKKGTVQQ
LPLQPAPTAPLRDRLRYHFPYDISNRFPAYIWQTWKYDPSSFWFIDDLRAPEASWTELHP
GFVHQVITDDTQRHLIKYYFASVPEVVEAYEALPLAVLKADLFRYLVLLARGGIYSDIDT
TALQPASEWLPQELDQSTVGLVVGIEADPDREDWHEWYSRRIQFCQWTIQAKPGHPVLRD
IVAYITEEALRMKELGVLKSKKMDKTVVEFTGPAAWTDAVFRYLNNPEYFKIDPETSRNV
TYEDFTGQEDRRKVGDVVVLPITSFSPGVGQMGAMDIDDPMAFVQHDFDGTWKTDPLL

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	113	192	6.7e-22	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.49e-37	71	355	66	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.52e-17	114	193	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89353.1|GT32	1.53e-246	1	358	1	361
CBV36935.1|GT32	4.34e-195	1	358	1	359
QRD84625.1|GT32	2.62e-190	1	358	1	363
UDD58159.1|GT32	7.50e-190	1	358	1	363
CAK39413.1|GT32	1.46e-189	1	358	1	362

PDB Hits     

ASPGLDRAFT_67299-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	8.99e-90	71	355	83	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	4.50e-78	72	355	129	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.34e-70	64	356	107	391	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	7.13e-68	71	355	80	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.546200	0.453806

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_67299-t33_1-p1.