CAZyme Information: ASPGLDRAFT_66565-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_66565-t33_1-p1
• CAZy Family: PL26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	KV878897|CGC6	52350.28	6.3681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878897:598123-599578(-)

Full Sequence      

MITPRLYRRRITWVASLVALFLLYHFFSLRSDLDAPAVAARTKTSQNANTSPNANADSST
NQNANSNANNGEKAQDRPICPPLPGMEDVLVVLKTGVTEALDKVPVHFQTTLRCVPNYVI
FSDHDEEIAGVRIHDALRNMPDEALKQSIPDFNIYNRIRSMGRAGLAQDDFSDVANSALG
KPDNPGWKLDKWKFLPMAMGTYKYKSDAKWYVFMEADTYFVWGSLLAWLENFNPEDPLYI
GTETQIADVIFAHGGSGFVVSNPAMKRVVDEYSVKSNEIHAYTAGHWAGDCVLGKILLDV
GVPLHFSWPMLQNTAVAELDEFSPDFYRRPWCYPAVAFHHLSALDIQSLWEFEQKRYKES
RKTLLLHGDVFKERIYPELAPDRSYWDNLSTEEHSVAIDTYEDCQALCATAPQCLQFTFR
AGRCYTNKTPKLGRSSADSSSGWIMKRVDGMLASAPKCRRPDFG

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_66565-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	6.57e-04	206	271	209	283	hypothetical protein; Provisional
367085	Fringe	0.002	204	331	81	228	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
238533	APPLE_Factor_XI_like	0.005	395	425	21	53	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR91502.1|GT31	0.0	1	464	1	462
QRD94340.1|GT31	1.50e-204	4	464	3	426
BAE63422.1|GT31	1.50e-204	4	464	3	426
QMW45989.1|GT31	1.50e-204	4	464	3	426
QMW33935.1|GT31	1.50e-204	4	464	3	426

PDB Hits     

ASPGLDRAFT_66565-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPGLDRAFT_66565-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000004

TMHMM  Annotations     

Start	End
12	29