CAZyme Information: ASPGLDRAFT_63668-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_63668-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546		60502.76	6.6522

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878889:1701131-1702835(-)

Full Sequence      

MATTTVTTSEFPASDVNNYDYIIVGGGTAGCVIASRLAEYLPNKRILVIEGGPSDYMDDR
VLKLREWLNLLGGELDYDYPTVEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCRR
WEKMGCKGWGFETFTRLLDGLRNTVQPVHENHRNQLCKDWVQSCSTALNIPVLSDFNKEI
RSKGELNDGVGFLSVAYNPDDGRRSSASVAYIHPILRGEEKRPNLTVLTNAWVSRVNVEG
NTVTGVDITLQSGVKRTLRAKRETILCAGAIDTPRLMLLSGLGPREQLSSLNIPVVKDLP
GVGENLLDHPETIILWELNQPVPPNQTVMDSDAAIFLRREAANANGDDGRASDIMMHCYQ
IPFCLNTERLGYDVPKDAFCMTPNIPRPRSRGRLYLTSADPSVKPALDFRYFTDPEGYDA
ATIVAGFKAAREVAKQSPFKDWIKREIAPGPKIQTDEDLSEYGRRAAHTVYHPAGTTKMG
DTTSDPKAVVDPKLKVRGLNGIRIADAGVFPDMPTVNPMLTVLSIGERCAELIAEEAGWT
RNQPRL

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_63668-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	543	1.5e-92	0.5210355987055016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.81e-117	17	538	6	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.37e-113	19	533	6	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	6.86e-43	388	529	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.06e-35	9	526	38	569	Protein HOTHEAD
366272	GMC_oxred_N	1.91e-27	19	311	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS03844.1|AA3_2	0.0	7	546	92	631
BCS15458.1|AA3_2	0.0	7	546	3	542
CAK47101.1|AA3_2	0.0	7	546	3	542
EAA64559.1|AA3_2	0.0	7	546	3	542
BCS21375.1|AA3_2	0.0	7	546	3	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	2.29e-120	19	533	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	3.24e-120	19	533	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	9.10e-120	19	533	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6YS2_AAA	3.10e-56	19	537	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	4.29e-56	19	537	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.18e-119	19	533	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	1.18e-76	18	534	6	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q4L9D7|BETA_STAHJ	1.04e-70	14	533	2	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1
sp|Q9X2M2|BETA_STAXY	9.05e-70	18	533	4	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus xylosus OX=1288 GN=betA PE=3 SV=1
sp|Q4A0Q1|BETA_STAS1	1.26e-69	18	533	4	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000020

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_63668-t33_1-p1.