CAZyme Information: ASPGLDRAFT_51703-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_51703-t33_1-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		26084.02	4.0885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878912:33980-34711(+)

Full Sequence      

MKLPIIILATLATCMARDIPSNLQRFYDTVKNAGPCTGDDLLQDGLFDQDDSTDEWSYCD
RNFTGRGLYIKGPGTDLANTDIDCDGDQQNADPRCLGSSDTQPATAFRRQVQRLSNITDL
NASIHPYVVLGNIGAVTFDPRDHGIEPLSVVAVVCGGQLIYGIWGDINGNDGMALVGEGS
LALATACFGDSMNGNNGHDEPDVLYLAFSGRNAVPRNANWAARSYEEFEASIMALGDALV
ARV

Enzyme Prediction     

EC	3.2.1.132:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	10	242	3.4e-63	0.9636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	6.03e-80	81	242	2	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85999.1|GH75	7.34e-159	1	243	1	242
QKX64743.1|GH75	3.86e-93	9	240	13	247
QGA18329.1|GH75	7.50e-93	9	241	13	247
AFG33049.1|GH75|3.2.1.132	5.15e-91	9	241	13	248
UQC81268.1|GH75	2.17e-74	16	243	21	255

PDB Hits     

ASPGLDRAFT_51703-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	3.37e-54	7	243	9	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	6.73e-49	6	241	9	241	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	6.73e-49	6	241	9	241	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	4.77e-48	1	241	1	237	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	6.19e-48	1	241	1	234	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999719	CS pos: 16-17. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_51703-t33_1-p1.