CAZyme Information: ASPGLDRAFT_49656-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_49656-t33_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	KV878903|CGC2	51373.29	9.3475

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878903:584150-585647(+)

Full Sequence      

MSSVKQVDRPSLLNPLRPLWSLTVAFVLWKSLLFLVVIACPGPGYDTSTSLLPYLNPSPT
RPAADAGVGSTLPLKFVRWDPIYFVHIVQHGYVYEQEWAFGYGFTRIWRFVASFLNPSAE
VGNVAQVAWVGVGLAHLAHYLSVLALYKLSANVFGRETPTQRLVCFLSAALHIIAPAGAF
LSAPYPEPIFSFLNIFGLYLYSSSFLDDGAGRRLPRDAKLLGAAVSFAVATTVRSNGILS
GFLFAYDAIWQLRRILLHGLSWDVVMRLGVIVVGGCVVALGIILPQWVAYTTYCTTSSRP
WCQWTLPSIYGWVQEQYWNVGFLRYWTVSNIPLFLLAAPMLVLLCYASLWALKMPWAAVK
ERPTTVLDRTMSPEATDSLLVRLAVPQGLLAVMAFTSYHVQIINRISSGYPLWYWYLVCL
VVDRAGGSPSAAKSNRLFAMVLQAMVIYGFIQAVLYGSFLPPA

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_49656-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	24	463	4.2e-112	0.9926289926289926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.21e-38	22	463	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.51e-15	78	417	76	363	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR82784.1|GT76	0.0	1	463	3	465
BCS01167.1|GT76	1.02e-190	8	463	11	469
BCS12914.1|GT76	1.02e-190	8	463	11	469
QMW40534.1|GT76	1.12e-190	1	463	1	452
QRD82967.1|GT76	4.54e-190	1	463	1	452

PDB Hits     

ASPGLDRAFT_49656-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	8.26e-184	1	463	1	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.63e-162	12	463	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.27e-86	17	463	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	9.95e-86	17	463	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	3.11e-45	21	463	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000008

TMHMM  Annotations     

Start	End
20	42
128	150
163	185
189	206
268	290
330	352
438	460