CAZyme Information: ASPGLDRAFT_45840-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_45840-t33_1-p1
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		64466.23	5.8469

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878894:1138325-1140064(-)

Full Sequence      

MVKNGSYFDFVVVGGGTAGNTVAGRLAENPNVTVLIVEAGVGNPLEVEEITTPSSAMDLR
NSKHDWAYKSTMVKRDDYERIEKPNTRGKTLGGSSSLNYFTWVPGCKPTFDMWEEYGGKE
WTWDPLVPYLRKSATYHDDRGIYEADLSKIGAGGPVHISHAELLDEMEPFRDAVTRAWTS
RGHPLTENIYDGKMIGLTHCCDSIYKGVRSGSFLFVQDKPNITILPQVHSKRLIIDEADR
VCKGVTVIDPSGNELKFYASREVILSQGVFETPKLLMLSGIGPSRELAKHGINTVVDSRH
VGQHLIDHPGVPFVLRVKDGYGMDDHLLRKGPQNATTVEAYKKNRTGPAASGLLELVGFP
RIDDYLEKDEEYRKAKAANGGKDPFSPYGQPHFELDFVCMFGSAFQWHYPVPKQGNYLTV
VVDLVRPVSEPGEVTLNSADPLVQPNINLNFFANDLDIIAMREGIRFSYDVLTKGDGFKD
LVVDEYPWEMPLDSDDEMKRAVLDRCQTAFHPCGTARLSKNIEQGVVDPKLKVHGIKNLR
VADASVVPVIPDCRIQNSIYMIGEKCADLLKADHKDLFE

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_45840-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	573	1.7e-147	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.79e-86	8	575	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.39e-80	8	569	6	530	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.54e-40	427	566	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.07e-21	87	309	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.77e-18	8	563	56	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85434.1|AA3_2	0.0	1	579	1	579
UDD59638.1|AA3_2	0.0	1	578	1	578
QMW42855.1|AA3_2	0.0	1	578	1	578
UPL02484.1|AA3_2	0.0	1	578	1	578
QRD89697.1|AA3_2	0.0	1	578	1	571

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	4	578	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	4	578	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	4	578	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.25e-67	8	573	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.72e-67	8	573	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	2.31e-59	8	570	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q7X2H8|CHOX_ARTGO	2.34e-54	8	572	14	528	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.62e-53	8	570	41	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|A0A3B1EFP9|STR4_STRTC	3.74e-52	8	571	36	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	7.44e-52	4	570	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000005

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_45840-t33_1-p1.