CAZyme Information: ASPGLDRAFT_44253-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_44253-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		51854.90	6.1965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878892:405903-407315(-)

Full Sequence      

MRRYLRKLRSTPAVVLLFVILVFLLPYDNPFSPRAAIVSAASALFEKRWWLINKPGAYPV
DFSQDVAVLIKSGVGTKERIPSWLKAHEHMELSDVLLIGDFATLPGQEYQYRDRRLPVHD
VLGWMIGKGYLAAELEHPRLEKYYNLTRAVDRGDVDAARKMSGSFGWELDAMKFLSGMEL
LHNRFPDKKWYIMADDDTYLIQPSFKRLIEHFNPNREQYLGNPVGGEDCRFAHGGSSIIL
SHRAVSHLISDHEYLAMAHRESLDETWGDKRLAVSLNRLEIYINEEYATFFNGESPHISK
ITKERLCTPVLSFHGLSSSSDMLTVSQTFEHATEQVLWVDLWNIPISDNSASGLLPKAST
SLFDDPIYDTGHKNWDYVGRLDEWTQSVEDVTSVDTCKQICREERSDFCLAWTWDSNEKK
CHMSWWIIKGDNAEGKTSGLSVPAVKDIVGSCRP

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_44253-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214680	PAN_AP	2.28e-05	380	425	13	57	divergent subfamily of APPLE domains. Apple-like domains present in Plasminogen, C. elegans hypothetical ORFs and the extracellular portion of plant receptor-like protein kinases. Predicted to possess protein- and/or carbohydrate-binding functions.
394981	PAN_1	8.50e-05	380	426	11	55	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.
367085	Fringe	1.57e-04	178	241	73	152	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
238533	APPLE_Factor_XI_like	0.002	391	423	24	54	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR84170.1|GT31	1.61e-305	1	454	1	454
QMW46572.1|GT31	3.16e-157	6	453	5	446
UDD63456.1|GT31	3.16e-157	6	453	5	446
BAE56843.1|GT31	6.35e-157	6	453	5	446
QRD93690.1|GT31	1.28e-156	6	453	5	446

PDB Hits     

ASPGLDRAFT_44253-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPGLDRAFT_44253-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999942	0.000077

TMHMM  Annotations     

Start	End
13	27