CAZyme Information: ASPGLDRAFT_42510-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_42510-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
904	KV878889|CGC6	98418.43	7.1007

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878889:1708500-1711379(+)

Full Sequence      

MGFDGTSVNPQIRSLIENHYLGSVLLSAKNLKSAEEATRLVLELQTIARNAGHPVPLLIA
LDQENGGVNSLYDETYIRQFPSAMGVAATGSQALAHEVALATAQELKAVGVNWILGPVLD
VLTNVKSQPLGVRTTGDDPQEVSQYGTEFMRGFQEAGLATCGKHFPSYGNLEFLGSQADV
PIITETLDQLSLSALVPFRNAISHGLDSMMVGGVSMSSAGVNVMHACLSEQVVDDLLRKD
LDFRGVVVSECLEMEALTHNIGVGGGTVMAKNAGCDIILLCRSFAVQQEAISGLKLGVEN
GIISRGRIEQSFRRVLQMKARCTSWEQALNPPGLHSLTQMQPSHTSLAKRAYGGSISVMR
DKRDLLPLSGILDPNEELLLLTPLVKPLPASAVSRSVAAHLGLSLEDPIAWDRTASVLSG
ESVFKELGRSLSRQRNGRVLHTSYTTNGVRPIHENLIERASAVIVVTADANRHLYQHGFT
KHVSMLCRMSQAGQPREKPLVVVAASSPYDFATDRSVETYVCTYDFTEPALEALVQVLYG
ELTPTGSLPGSISRSQKLHQARQHWLVENWNEERDAHALDALLDIVRADSAQNSELQGVT
SNSFLLRRAEVVEAHLVVRNSSTQALYGFCSTYFFRSTGTGIIGSLIVDPSRRRLSIGRS
LHHRAIHTLLQCKGIKRFQLGSRLPGIYLGIPATHPVERKRLRQWFANLGWNTALSRPVC
SVVLRNATTWTPPNGLVDTLQNHTAVRYDLVYGWDYADVVLDHVRTNSRPGLQDIYHVAL
GDAPDCGIIRALRADDGEMLGSVVIYNARSVLAAHMAALKNQPVLAGGVSSPVISPLVGE
YATVLQGLIFLGIKQSRKQGAKAVVLDCVNGDSNLDCLSRMGFEMLHRFEEVNCDATVWM
GPHP

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_42510-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	53	279	3e-53	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	8.67e-67	1	369	10	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	8.31e-58	2	316	13	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	4.86e-33	5	344	10	336	beta-hexosaminidase; Provisional
178629	PLN03080	4.45e-08	80	549	114	585	Probable beta-xylosidase; Provisional
185053	PRK15098	4.82e-08	79	319	119	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90827.1|GH3	0.0	1	904	25	928
BCS15461.1|GH3	0.0	1	899	25	925
BCS03847.1|GH3	0.0	1	899	7	907
BAE65506.1|GH3	0.0	1	899	54	955
QRD92904.1|GH3	0.0	1	899	7	908

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.37e-91	2	711	20	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.13e-61	2	553	24	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.00e-42	6	552	71	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.65e-42	6	552	45	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.84e-42	6	552	75	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.03e-41	6	552	71	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	1.47e-32	6	549	42	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	4.87e-31	6	553	49	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|B4SRK3|NAGZ_STRM5	2.31e-28	1	308	4	309	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|Q3SKU2|NAGZ_THIDA	2.70e-28	5	308	12	308	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_42510-t33_1-p1.