CAZyme Information: ASPGLDRAFT_37590-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_37590-t33_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640		72243.15	4.4378

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878904:55257-57509(+)

Full Sequence      

MHLSYSLFAPLLGALAAARSIPNTYHQNIARSTPYAVKQSPLDTPWTEEVGNSPWPEYPR
PQLQRTQWKNLNGLWQYQNASNQDAVQQPPTNQTLANEVLVPSCLESALSGIQGKDMFYS
WYSTKFDVPSSWNGQRVLLHFGAVDYEATVFINGKNAGFNRGGYFHFEVDVTDYLSSNEG
NELLVFVYDPTDDGENVIPIGKQTLNPSHIFYTPCSGIWQSVWLEPASSNWITQLDLDAN
MDGQVNVTVHSAEGNATSVEVTVYDNDDEVASHTGQSDEPFVFKVSEPKLWSPDSPNLYN
VTVRLGNDQVQSYTGFRTISKGKIDGIVRPLLNGKFVFMFGPLDQGYWPDGLYTPPSLDA
MVYDLKFLKDLGFNMVRKHIKVEPALFYQACDELGLLVIQDMPSMRPLQERTESDCKKTR
LLADDRQQTEFGRQLEVMINQFRSYPSIATWVIYNEGWGQITDYYPEFELTERVKTLDPT
RLIDSTSGWIDHGAGDFSDNHHYANPQCGTPFYSTDSSPYDPSRIGFQGEFGGLGNNVTI
ENLWHEQGAIDSINQTYEIDTTVEAWNYRSHALLSELEDQVRRYACSGGVWTQTTDVEGE
VNGLMTYDRRIKRVDEEQWKADIQALYDAAAARGGASQKK

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	62	560	2.9e-104	0.5598404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.34e-39	71	609	15	540	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	6.94e-39	60	481	3	443	beta-D-glucuronidase; Provisional
236673	ebgA	1.48e-22	68	497	41	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	2.22e-16	69	481	53	483	beta-galactosidase.
395572	Glyco_hydro_2	1.16e-13	231	317	7	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR88823.1|GH2	0.0	1	639	1	640
QQK41266.1|GH2	0.0	25	639	9	624
BCR96616.1|GH2	0.0	18	637	17	636
BCS09120.1|GH2	0.0	18	637	17	636
BAE58640.1|GH2	0.0	11	640	24	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	3.90e-125	42	620	12	576	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3GM8_A	2.57e-24	120	495	68	431	Chain A, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6U7J_A	4.82e-24	67	486	20	448	Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]
6XXW_A	6.34e-23	58	528	23	485	Structure of beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6ED2_A	1.25e-22	121	481	94	467	Chain A, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	6.16e-25	55	481	40	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	8.65e-23	118	480	56	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|T2KM09|PLH16_FORAG	6.29e-22	121	488	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|Q56307|BGAL_THEMA	4.74e-18	122	483	114	464	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|A1SWB8|BGAL_PSYIN	3.53e-15	122	496	122	496	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.153066	0.846899	CS pos: 18-19. Pr: 0.7554

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_37590-t33_1-p1.