CAZyme Information: ASPGLDRAFT_36971-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_36971-t33_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42056.17	5.6583

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878901:661515-662734(+)

Full Sequence      

MRHLTQALITINTLLAIAVAAPHGTSYNNIQHQKRDDQDQNQAPNLATKVEAELHPFPHP
HHHYNHDHHHGHGHHGKPPQPPPKKRKFGISYSPYNTDSTCKSQDEVNADIDRLVSASLP
QPENAEETEDSDYGFIRIYGIDCNQTATVTTAAKQHNLRVFAGIFDLSDFPHSLDAIIDV
AHSHTTTTSEGGEEDGWSIFHTIAIGNELVQTHQSTIPDVISALHQARSILRSAGYNGPV
VTVDTYTMLLEHPELCEASDYCAVNCHVFFDATQTPDKAGDYAVDVARRISEGTEGRSGG
RKRTVIAESGWPHDGVANGKAVPSGENQRVAVESLKRVFREQPGEGEDDGDAGLVLFTAF
DDLWKVDNEGTFGAERFWGINR

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_36971-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	118	380	1.6e-18	0.9196141479099679

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.27e-59	89	380	47	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.003	294	380	219	296	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83035.1|GH17	1.64e-207	1	382	1	385
BCS13276.1|GH17	4.66e-107	86	382	108	362
BCS01560.1|GH17	4.66e-107	86	382	108	362
CAK47997.1|GH17	2.65e-106	86	382	108	362
CAP97696.1|GH17	5.22e-106	88	382	124	382

PDB Hits     

ASPGLDRAFT_36971-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	1.54e-56	89	380	128	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53334|SCW4_YEAST	3.28e-53	89	380	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	1.45e-51	89	380	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53189|SCW11_YEAST	4.74e-37	90	380	284	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q4WC60|BTGE_ASPFU	3.79e-32	87	379	308	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999731	CS pos: 20-21. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_36971-t33_1-p1.