CAZyme Information: ASPGLDRAFT_36790-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_36790-t33_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269		29842.99	7.7467

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878901:179286-180182(+)

Full Sequence      

MLRLALSSAWQRALSPNLDILFCNRSSLKNMVTRFSTPERAHSYSSLTPHGESPPTLAGV
SLRLMPLGGSITQGVGSSDLNGYRKSLLELLQSCDCDIRMVGSRKTGSMEANDHEGWRGF
RIDEIEKKAKKSVAKLKPNIFTVNAGSNDCLQSFEIEAFGKRTSDLLEYLWLASPQSTVI
LSTLVINADQRVDSRVLRVNDQIRALIEQKSASQKRVVLADMYTGEGPEIHDLVDGTHPG
DVGYKKMAWIWFNSIQEAAVKGFLQEPEN

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_36790-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	62	255	5.3e-58	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.63e-44	62	255	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	9.23e-15	67	248	4	181	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	5.62e-13	67	246	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238870	SGNH_hydrolase_like_1	2.33e-08	67	248	5	179	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
238872	SGNH_hydrolase_like_2	1.36e-07	67	251	7	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68641.1|CE3	7.19e-87	36	266	27	256
QKD62224.1|CE3	1.82e-84	65	266	1	202
CAP79838.1|CE0	2.51e-81	61	264	103	306
UKZ67969.1|CE0	5.17e-78	62	265	60	263
QYT04935.1|CE3	2.42e-77	51	264	40	254

PDB Hits     

ASPGLDRAFT_36790-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	2.87e-10	46	256	29	261	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_36790-t33_1-p1.