CAZyme Information: ASPGLDRAFT_36698-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_36698-t33_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	KV878900|CGC1	52668.63	7.0888

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878900:791378-792857(-)

Full Sequence      

MALPSCSFWRLRRSTLSALYVIFTVIFFCIVSIWYGMNSDRNYIHPLLTQLIPAGHCACQ
TSTTFQCSSCLSCSQTNLLQQLTPSTNWRYQYERDTGDESLDRGQCRTAFPGLFEDVFRA
VNYWRYHGNLATEDLDRINLQPGMARASIYRGELYVNAARAKGEDHRQKILAVLSAIHRA
LVADRDRRSRDMSFIFSVEDKVEDVTSSEYPVWVFSRAATEEAVWLMPDFGYWAWDNSLN
PIGPFDQVVEHIQEVDVPWPEKKRQLVWRGKPSFAPKLRRALLEAARDKAWGDVKQVDWQ
EKANIIKMEDHCKYMFIAHVEGRSYSASLKYRQACRSVIVAHKLQFIQHHHYLLVSSGPE
QNYVEVERDFSDLADKLEPLVENPDAAKRIADNSVRTFRERYLTKAAEACYWRALFDGYG
AVWNSSGVRDARERGLRYESFVLLESSEMVEFAHS

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_36698-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	191	420	5.1e-22	0.964

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.42e-20	188	420	1	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.15e-17	191	420	81	320	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89787.1|GT0	0.0	1	455	1	455
BCS06430.1|GT0	3.91e-242	1	452	1	458
BCR93809.1|GT0	3.91e-242	1	452	1	458
QMW31614.1|GT0	2.62e-240	1	453	1	459
UDD60541.1|GT0	2.62e-240	1	453	1	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	5.03e-07	214	419	155	375	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	2.79e-08	211	430	163	395	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	8.71e-08	207	430	158	396	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	2.64e-06	214	419	167	387	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	4.52e-06	206	431	158	394	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	6.13e-06	149	419	112	385	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000001

TMHMM  Annotations     

Start	End
16	38