CAZyme Information: ASPGLDRAFT_28820-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_28820-t33_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840		91212.15	7.9660

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878909:457552-460370(-)

Full Sequence      

MSSSKAQPVADELFLDQPPPPYLEIAEDAAGVQDDGRIEVDLESSACKAAIKLIPWPSED
FDVPPPVYTEVVTSKAKLNIVIQVVGSRGDVQPFIALGNELQKHDHRVRIATHNVFDSFV
RNAGLEFYPIGGDPADLMAYMVKNPGLIPKMKSLRAGDIQRKRSMVAEMLQGCWNSCLED
DPLTATPFVADAIIANPPSFAHVHCAQALGIPVHLMFTMPWSHTTAFPHPLANLKYSETS
ANFANFASYGIVEWMTWQGLGDVINDWRKTIDLEAVPVTEGPNLAATLRIPFTYCWSPAL
IPKPADWASHIDVCGFFFCDPPNYQPPPDLDAFLRSGPPPVYIGFGSIVIEDPERLTAIL
LEAVRMAGVRAIISRGWSKLGGSSPSTRDVFYLGDCPHEWLFPRVAAVVHHGGAGTTACG
LRYGRPTSIVPFFGDQPFWGNMVAAAGAGPKPIKHTLLNANNLADAIRLCMRPETSTAAG
NIANMMQAECGIQTAVESFHRNLPWDMMQCQILPDEPATWVYKKSLSKPLFLSKIAAQVL
ADHLRLDSKDLQFHSPNPIVILNRRWDPITGTTSAAIGTGADLARATTDMFLKPYQEISR
GRGGSSRPSTPRTTSSSSVQRAESDSQVPTAEEMTRAIAQDPRSGWITTGRAVGAGAKGV
GKFLGSYYKGVLVDIPLATTEGLRAVPRLYGEDVKDYNVKDWKSGALAGGRNFAHGMSRG
LADIVRQPYKGGVEDGAVGAAKGFAKGTIGLTTKMSSAALGLVAYPGYGITKSIHAAIRT
KTRKNIVKARKREGEHRAMIAVASGLDHSAMLRSFEAYKRENTETRPSDSRPSSRWQEPA

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	158	500	6.5e-52	0.8219895287958116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.51e-80	78	501	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.72e-40	80	501	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.31e-23	80	228	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.97e-07	89	449	7	336	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	1.24e-04	660	774	2305	2413	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW26390.1|GT1	0.0	19	823	21	811
QMW38469.1|GT1	0.0	19	823	21	811
UCK58945.1|GT1	0.0	19	823	21	828
QRD87509.1|GT1	0.0	19	823	21	828
BAC56174.1|GT1	0.0	34	823	42	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.10e-77	85	505	27	441	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.57e-77	85	505	47	461	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.55e-32	78	489	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	4.26e-32	78	482	1	365	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	9.64e-28	78	486	1	383	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.41e-131	32	504	110	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.05e-126	78	504	193	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	2.79e-77	72	505	989	1415	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q54IL5|UGT52_DICDI	5.37e-76	78	514	1164	1620	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|A1CFB3|ATG26_ASPCL	5.50e-75	78	503	908	1325	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_28820-t33_1-p1.