CAZyme Information: ASPGLDRAFT_182493-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_182493-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810		89048.61	7.3436

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878934:24500-27135(+)

Full Sequence      

MANPVNDNRDPPPYEAISPASPETEDLSPSDVPPYPAAPLPEVTTTNDGRVDVRVGQRFS
RNVEWLMRRSSTRQPTDEHETSRPRPHPTWSIKLNIVIQVVGSRGDVQPFIALGTELQKH
GHRVRLATHATFEHFVTTTGLEFYPLDGDPAELMSYMVRNPGLIPSMKSVRAGDIQKKRA
IIAQILDGCWQSCIQPDPHSGKPFVADAIIANPPSFAHVHCAQALGVPVHLMFTMPWTST
REFPHPLANLSYSGSDPSLGNLVSYHFVEWMTWQGLADLINGWRKDVLELEPVPATEGPN
LAETLQVPFTYCWSPALVAKPPDWGSHIDVCGFFFRDPPAYHPPGDLVEFLNAGDTPIYI
GFGSIIVEDPEKMLSILLQAVEITGVRAIISRGWSNFEAPGNSNVYFLGDCPHEWLFQHV
AAVVHHGGAGTTACGLRYGKPTTIVPFFGDQAFWGSIVASAGVGPSPIPQKSLTAENLAD
AIKFCLAPSASTTARALARKMNSESGVRAAVDSFHAHLPRKEMLCDILPDEPAAWRIKRG
KTTVRLSKLAACALVRERRLQRKHLKRLETKPIVIDIRRWDPLTAISSASLSTMSGMADA
TAGIILDPYREYKRHRSTSNPEDTPTTDPQTSNPNHARQMLLLSLTSLGKFLGRASRGAL
LDLPLAATEGMRSLPRLYGDPVRNHTPITSLETGALVAWSTFMHGVYEGVTDIFVHTYRS
KKEQGALGVAKGLTKGLVSLTVKTGSATMGLVAYPSQGAYRGLRRGFRKGVGERVEEGRW
VEGEEIMGREVCDRERVCEVFEEVVCSREI

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	120	516	1.5e-55	0.9659685863874345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	8.24e-82	94	517	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.76e-37	96	516	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.08e-25	96	244	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83629.1|GT1	0.0	1	810	1	818
BAE60619.1|GT1	0.0	11	809	17	858
QRD89795.1|GT1	0.0	11	809	17	858
UDD59733.1|GT1	0.0	11	809	17	858
QMW30890.1|GT1	0.0	11	784	17	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.29e-75	86	518	8	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.17e-75	66	518	14	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.51e-28	94	510	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	4.85e-26	94	510	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1PN3_A	1.09e-21	94	488	1	358	Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	3.55e-138	94	530	193	623	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	1.46e-133	93	519	155	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	1.76e-79	94	519	1164	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q5A950|ATG26_CANAL	1.27e-74	91	518	1012	1433	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2
sp|P0CN91|ATG26_CRYNB	1.18e-72	94	529	1034	1474	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_182493-t33_1-p1.