CAZyme Information: ASPGLDRAFT_181030-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_181030-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514	KV878918|CGC2	57338.69	5.3340

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878918:207429-209205(+)

Full Sequence      

MVLHRPSRLFGLSLLLQLGQGKADTVAVPSCPKDTEPVANDLQSFSIEFSYFPDFTGKKS
HPNEFSRTLLGNLKDITGVAPVIRVGGTTQDRAEYHPSQKEPIRNIFENPDDDQPIKTDF
GPGFFESYEVLGDFPYIHGLNFNLSLAQETSSTIAMCKLMNTKNLHLYELGNEINMEPTR
YRPANYSMADYIREWNYKSTAIAAAYKKACGGPFPGMMAPSFILPSFDLADSTPWTIEGI
YANGYDKNNLTREICAHQYMQENRPPQLPPATRLQRILMNHTNIVESLGPHIQRAKNLEY
LDHPYVLGEMNSIANQGRDGESNVFGDALWLVDFSLWAAEHNIKRLNFHQGTSYRYASWQ
PILNKGIAPTTKPPYYGQIMVAMALGRSENMRIRNIPLSGHNEAAYALFDNSRLSKLVVL
NMEAFNSTSGADSRSSQEYKFKVLGGSKSANVQRLIAPGSDVEKNVTFGGISYDYELEKG
NAVVVDDMEETVEIEDGVLSITVPDSSAVLLTLD

Enzyme Prediction     

EC	3.2.1.31:3	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	43	444	2e-57	0.843956043956044

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	1.13e-29	405	510	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85331.1|GH79	0.0	1	514	1	514
BCS28621.1|GH79	1.29e-195	8	513	7	511
QKX52979.1|GH79	2.03e-191	11	512	9	527
BCR90385.1|GH79	2.50e-121	11	513	8	509
BCR93948.1|GH79	7.62e-93	4	513	3	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	8.95e-37	25	514	4	460	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5BWI_A	4.08e-08	19	424	8	368	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	5.31e-93	30	513	40	541	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	1.30e-72	35	495	30	528	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999656	CS pos: 23-24. Pr: 0.9430

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_181030-t33_1-p1.