CAZyme Information: ASPGLDRAFT_168696-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_168696-t33_1-p1
• CAZy Family: GH142
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	KV878894|CGC4	92821.89	6.1434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878894:371526-374286(-)

Full Sequence      

MPPTDLRKQAGQLFAVGFHGLVPSPEIKTLIHDYGLGGIVLFKRNIRDAEQLQSLTLALQ
TEAKAAGHEHPLFIGIDQENGLVTRISPPVAAQVPGPMALGAANSEALAHEVGKATGQTL
DFFGINMNYAPVCDINSEPLNPVIGVRSPGDDSEFVGRVASAQAKGLREQKIVPSVKHFP
GHGDTAVDSHYGLPVISKTRDQLERCELVPFRRAVAEGIETVMTAHISLPAIGDGELPAT
LSVDALNILRKDMNYDGMVITDCLEMDGIRATYGTEQGAVMALKAGSDSIMVCHTYAVQI
ASIDRVWEAVQSGTIPMARFQQAFRRVTDLKDRFLSWDTALRPRAIENLASINTGTAAVA
KEAYSRSVTLVRSKADILPLSESPKVVFLFPGANTPAGGAVDGEGLGRKGSYDATVYLDS
IQKYNANAVEIRYGMEGLSAEQWRQIEAADVVIFTSINARESPYQRTLGLELPKRVRELV
AIAACNPYDFLEDSSIETYVATYEPTVEAFSAAADVIFGAAPAKGVLPVGPKDTPDVPIT
VSSLDLGSDLEQLATVWNTTLPGYPLSSDRLRTLLDRPSGHYFVARSGSVLVGFSLAYTT
VNGGITSGQLAVLAVGPAYQGRGIGTTLITETRAWFRQNLGLNRLALGSAFPRFWPGIPT
DLPSKIQEFFTHRGFRLSPPTSRSVDLYQDIRGFQSPEKYIVRAKERGYTFGVLLPEHYE
ECVAAQKRNFTDYTGWVEAYIVLQPNKYPSNVMVAFNKEGNQVGWTLMLPPSSPLLQRGW
AFPPLCGLKTGLIGCVGVDVAHRKGGVGLALMCHAIENMKQRGIEGVFVDWVSLDGWYEQ
VGFEVWRSYRPGMI

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	68	292	5.4e-57	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	8.89e-85	6	399	3	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.24e-77	6	330	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.20e-39	37	335	27	337	beta-hexosaminidase; Provisional
185053	PRK15098	5.17e-13	4	600	39	650	beta-glucosidase BglX.
395465	Acetyltransf_1	1.87e-09	565	675	18	116	Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85716.1|GH3	0.0	1	854	1	854
CAP94355.1|GH3	0.0	1	854	1	852
CAK37722.1|GH3	0.0	1	854	1	857
BCR93582.1|GH3	0.0	1	854	1	857
BCS06215.1|GH3	0.0	1	854	1	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.93e-165	5	852	8	856	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.23e-94	6	528	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	4.54e-66	24	537	74	620	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.34e-65	24	537	48	594	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.50e-65	24	537	78	624	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.33e-65	24	537	74	620	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	6.02e-54	25	389	53	434	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|L7N6B0|LPQI_MYCTU	2.11e-37	7	331	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
sp|A0A0H3M1P5|LPQI_MYCBP	5.25e-37	7	331	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
sp|Q0A911|NAGZ_ALKEH	1.03e-36	16	294	8	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_168696-t33_1-p1.