CAZyme Information: ASPGLDRAFT_1512325-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_1512325-t33_1-p1
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	KV878892|CGC1	70990.90	5.6299

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878892:1366284-1368307(-)

Full Sequence      

MWSLSFLLGPALLAAVSQAGKTPYDEYILAPSTRNLVPETIYQINGSVSNADVLTSPGSG
NATFNGPASVTFDFGRNIGGIVSLDIASASSSAAFVGVTFTESSLWINSEACDATADAGF
DSPLWFPVGQGPGKYTAEKKHLRGAFRYMTVVTNTTASVSVRSVRVKYTAAPTQDLRAYN
GYFHSDDELINRIWYAGAYTLQLCTIEPSTGDSLTTLGEISSIDNITLPETVPWYNNYTI
SNGSTVLTDGAKRDRLIWPGDMSIAVESAAVSTGDLESVKNALEALFSQQKTNGRLPYAG
RPFTDRVSFTYHLHSLVGVSDYYRLTGDRTWLSRYWNQYKRGVQWALSSVDQTGLANITA
SADWLRFGMGAHNIEANAILYYVLDQAQDLASTLHDQTATNWSSIASGIKTAANQRLWDS
DAGLYRDNETTTLYPQDGNVWAIKANLTLSEKQSSIVSSSLRSRWGPYGAPAPEAGKTVS
PFISGFELQAHYLAGNADAALALMRTQWGFMLDDPRMTNSTFIEGYSTDGSLVYAPYNND
PRISHAHGWSAGTTAALTFYTAGLHLTGPAGSTWKFAPQPGNLTDVDAGFSTQLGAFSTT
FSKTDDGFQRVSFNAPNGTTGDVELVGAKGSLVSRKGRRVELVDGKAKGLAGGHWELK

Enzyme Prediction     

EC	3.2.1.40:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	244	625	6.7e-75	0.7321428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.86e-07	241	428	26	224	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
273702	oligosac_amyl	3.08e-05	293	421	340	461	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR84516.1|GH78	0.0	1	658	1	658
UDD56671.1|GH78	0.0	2	658	5	659
BAE58354.1|GH78	0.0	2	658	5	659
QRD83147.1|GH78	0.0	2	658	5	659
QMW28625.1|GH78	0.0	2	658	5	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	4.55e-13	69	550	94	531	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
3CIH_A	7.86e-13	70	583	194	658	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPGLDRAFT_1512325-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999777	CS pos: 19-20. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_1512325-t33_1-p1.