CAZyme Information: ASPGLDRAFT_148132-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_148132-t33_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155		15752.76	7.1034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878895:817380-817918(-)

Full Sequence      

MGNMGSVVGPPVAKQLASQTNNKVTVQGVDYPADAAGNVSMGSSGGPKMASLVKQALKQC
PKTKVVLGGYSQGSMVVHNAANSLSADQISAAVLFGDPFKAQSVGKLDDSKRKEYCAQGD
PVCLNGGNVMAHLSYGDDAEEAAKFLVDASGVSTS

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_148132-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	2	148	4.4e-38	0.8994708994708994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	7.35e-40	2	147	17	170	Cutinase.
223477	YpfH	5.12e-04	48	146	82	172	Predicted esterase [General function prediction only].
369775	PE-PPE	0.004	24	98	3	89	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89623.1|CE5	1.34e-98	1	155	127	281
CAP91879.1|CE5	1.61e-80	1	155	171	325
BAE58644.1|CE5	7.53e-80	1	152	59	210
QRD85183.1|CE5	3.11e-78	1	152	176	327
BCR96605.1|CE5	4.00e-76	1	155	138	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	5.01e-34	2	147	94	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	1.84e-20	2	151	36	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	1.62e-19	2	147	27	184	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
4OYY_A	2.02e-18	2	148	32	190	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
5X88_A	2.37e-17	2	148	38	196	Chain A, cutinase [Malbranchea cinnamomea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	3.62e-69	1	152	74	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|A8QPD8|CUTI1_TRIHA	2.01e-34	2	146	94	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|A0A024SC78|CUTI1_HYPJR	2.24e-33	2	147	94	244	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	2.24e-33	2	147	94	244	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2
sp|Q00298|CUTI_BOTFU	1.12e-32	2	152	46	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_148132-t33_1-p1.