CAZyme Information: ASPGLDRAFT_142582-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_142582-t33_1-p1
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	KV878890|CGC1	48293.89	7.1054

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878890:912278-913583(-)

Full Sequence      

MWAEKRHQSRLYAYKPRFRRRFLVLAFIAVCYIVFIYFPEPELPKKRTHNFTSPNKLAPE
YEEEFPKFVHTSSFRKDPDFEYEARIDAMLQEVERAALAENGGDYSAKDRIWQIMPEVKD
RGSDSKMLENKNNGWEYTPATDEWAAAFVADTLSKAPEIATTYQAYPYNVLRADLLRYLV
LWYYGGFYSDMDAFPARPIKQCPPLNPLFTEETNNHPNVSFILGVEIDEPYVAPKFMRKW
HWSRPYEFIQYTMYAPRRFSPILRKTIVRVLAHSRQHMDRWTIIPPRYDEPTVLEISGPG
VVTDAVIDSLSETLPPTHPLVNLSVEADEGVGDLLSSSGVTQRRVTWVPFHNIKEPVYID
ASEAAEGKAMGGLGVLPVSAWGNGQRHSNAEGFRGPNVCINHRFGGSWKINWWHRMFG

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_142582-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	130	203	2.2e-17	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	3.63e-13	126	204	9	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	4.24e-13	126	256	104	226	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86108.1|GT32	2.96e-301	1	418	1	418
BCS21634.1|GT32	1.28e-151	15	418	8	414
CAP98643.1|GT32	1.32e-150	6	418	4	421
QMW25899.1|GT32	6.63e-149	55	418	47	413
QRD88070.1|GT32	6.63e-149	55	418	47	413

PDB Hits     

ASPGLDRAFT_142582-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	4.24e-17	129	409	128	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	5.41e-14	111	356	134	347	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UTR6|OCH1_SCHPO	1.30e-13	111	409	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	1.32e-12	110	409	102	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	6.37e-08	135	290	88	240	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000003

TMHMM  Annotations     

Start	End
21	38