CAZyme Information: ASPGLDRAFT_133945-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_133945-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	KV878909|CGC1	74709.97	6.3786

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878909:215008-217097(+)

Full Sequence      

MAYPRPDFQPKNLHWISLDGIWDIIFDDADSGLSQSWHLKGIPSEAGTNKRRDIRVPYAF
QTPASGIGVHEVHEVIWYERTVSDIRTVDEINRGNRLLIRFGAVDYECSAWVDGHFVGYH
QGGHVPFDLDISDAFSRPDAAKKTTEARLTLQVRDSATDLAQPRGKQYWGPVPESIFYTP
TSGIWQTVWLESVPPMRLSCGSGGTVLRSDDIKRGLLHACVVVTGRPIGSQCSIEIESHL
AGQPVNKARGDLPKDREFVNIDLSMKVSNAADLKHKTPFNVEGCWHNGVALWHPDHPILY
DLVLRLYDSSGKEVDEVQTTTGMRHLSWQNGDGTFRINDKPFFQTMVLDQGYWDETGLTP
PSPEALKIDIELTKKMGFSGCRKHQKVEDPIFYYWADRLGFLVWGEMANAYAFGNDFVER
VNSEWIASVKRDINHPSIVTWTPANESWGYTSLKDNIEQRNHLRSVYYQTKTIDPTRPIN
DNCGWEHVLTDLTTYHDYSDSTELSVTCSNMGTGILGQKGGHDMFVPPFGSDPGTKHQPG
APVICSEFGGVNIAPSKNSPAASERDWGYTTASDPNDFLYRFEKLVMAIVKGGNSHGLVY
TQICDIEQEVNGLYSIHRKEKIPSERVKAIMDAAREYYYKNVAVQRTHLGSKVVHGLEKR
FHM

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_133945-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	14	567	1.4e-93	0.550531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.21e-31	3	480	1	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	2.31e-29	17	479	14	445	beta-D-glucuronidase; Provisional
236673	ebgA	1.97e-19	78	477	113	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
397119	Glyco_hydro_2_C	7.03e-14	332	549	5	211	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
397120	Glyco_hydro_2_N	8.35e-13	17	132	3	119	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR91041.1|GH2	0.0	1	663	1	663
QRD91609.1|GH2	0.0	2	643	3	647
QMW47280.1|GH2	0.0	2	643	3	647
QMW35218.1|GH2	0.0	2	643	3	647
CAK44902.1|GH2	0.0	2	643	3	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.48e-59	3	630	29	578	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	6.02e-19	16	554	21	520	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
3GM8_A	8.22e-19	22	479	13	421	Chain A, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5C71_A	2.59e-18	16	479	46	475	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6LEM_B	5.19e-17	18	479	13	439	Chain B, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18835|BGLR_CANLF	2.72e-19	1	479	27	478	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|P77989|BGAL_THEP3	2.98e-18	54	522	35	457	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|O77695|BGLR_CHLAE	1.03e-17	1	479	24	476	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1
sp|A1SWB8|BGAL_PSYIN	4.61e-17	3	492	60	497	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
sp|Q5R5N6|BGLR_PONAB	7.31e-17	1	479	27	479	Beta-glucuronidase OS=Pongo abelii OX=9601 GN=GUSB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_133945-t33_1-p1.