CAZyme Information: ASPGLDRAFT_132688-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_132688-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594	KV878906|CGC2	65532.10	5.7981

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878906:92564-94458(-)

Full Sequence      

MATTTNNSHFDFIIAGGGTAGNAVAGRLAENPNVRVLVIEAGTANPHQIEDITTPSKSFG
IRGSKYDWAYKSAMVKRDDYERTEKPNTRGKILGGSSCANYFTWIPGSKATFDDWAEFGG
DEWTWDNCVDYLRKCATYHDDEKLYPSDLDKIGTGGPVQIAHAELVPELQPFREALTSAW
VSKGEPLSEDIYSGEMHGLTHCVDTIYKGERQGSFLYLQNKPNVTILSSCNTKRLLIDGV
SNTCVGVSVVNPSTDTEHDFYADREVIVSQGVFETPKLLLLSGIGPAAELAQHGIKTVFD
SPHVGKHLLDHPIVPFVLRLKDGYTLDDHLLRAGPSNEAAVAAYRRDKTGPAASGLLELV
GFPRIDERLNKYPAYRETKAANNGLDPFGPGGQPHFELDFVGMFSTAFQWHYPVPKEGNY
MTVIVDLLRPVSEGGEVTLNSANPLVDPNINLNFFANDLDILAMREGVRWTYDVLLNGQG
FKDIVVGEYPWEMPIHSDEAMNKAVLERSQTGFHPCGTARLSKSVHQGVVDSKLRVHGVK
NLRVIDASVMPVIPDCRIQNSVYMIGEKGADIIKAQHKDLYEMKGIPYFIPSKL

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_132688-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	575	2.8e-148	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.89e-91	5	574	1	532	choline dehydrogenase; Validated
225186	BetA	2.54e-81	7	578	5	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.79e-41	430	568	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.84e-24	89	313	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.80e-18	10	566	56	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR87142.1|AA3_2	0.0	1	594	1	594
QMW45821.1|AA3_2	0.0	1	594	1	593
QMW33775.1|AA3_2	0.0	1	594	1	593
QRD94528.1|AA3_2	0.0	1	594	1	593
UDD62603.1|AA3_2	0.0	1	594	1	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.49e-306	5	581	2	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.27e-306	5	581	2	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.22e-305	5	581	2	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	4.31e-71	10	575	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.33e-70	10	575	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5WA97|BETA_PSEP1	1.84e-61	7	576	2	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=betA PE=3 SV=1
sp|Q88CW6|BETA_PSEPK	3.56e-61	7	576	2	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=betA PE=3 SV=1
sp|B0KN19|BETA_PSEPG	2.56e-60	7	576	2	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=betA PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	5.03e-60	10	573	41	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q1IG70|BETA_PSEE4	6.84e-60	7	576	2	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000009

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_132688-t33_1-p1.