CAZyme Information: ASPGLDRAFT_131774-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_131774-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		41680.78	7.2810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878904:517077-518324(+)

Full Sequence      

MRRGVLIFLVVNLIILSFLVRSVFTLLSLLVEDASADAIHRAELPSPNSSLIEQRPQVIP
KIIHQTYKNESIPEVWIDAQRSCIDLHPDYEYILWTNEKARDFIAKEYPWFLDTFDGYKY
PIQRADSIRYFVLAHYGGTYIDLDDGCNRRLDPLLAYPAWVRRTAPTGISNDAMGSVPQH
PFFLRVIELLQSYDRSWLLPYITVMYSTGPLFLSVLWKEYMLDKPSEADRVRILMQDEYN
RYSWSFFTHHVGNSWHGKDAQLIFWMGQHWMFLTLCGFALAGVVGLGSWWIYGRVMHLSS
RYRHGYSKVPTIVTPAGLSPTRRARLAVPTLLRRVSFNKEDEETGPTETSYEFYSRND

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	1.1e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.81e-75	5	285	14	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.19e-26	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89010.1|GT32	1.47e-266	1	358	1	358
QMW44769.1|GT32	5.83e-232	1	358	1	358
BAE61832.1|GT32	5.83e-232	1	358	1	358
QRD84258.1|GT32	5.83e-232	1	358	1	358
QMW32739.1|GT32	5.83e-232	1	358	1	358

PDB Hits     

ASPGLDRAFT_131774-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	7.42e-103	1	292	1	296	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.27e-102	12	292	12	288	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.03e-92	37	302	56	323	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.34e-87	48	278	46	277	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.39e-55	59	269	64	275	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.313037	0.686944	CS pos: 36-37. Pr: 0.3825

TMHMM  Annotations     

Start	End
5	27
270	292