CAZyme Information: ASPGLDRAFT_129062-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_129062-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	KV878900|CGC7	33277.94	6.0843

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878900:718269-719241(+)

Full Sequence      

MILFSGSSVVQGASSPGCGKALPRVQEPGGSFSTKITTNDGRKRSYIIHIPSNYDENKPV
PVIFSFHGRTRTAESQETLSLFSNEEYNPDAIAVYPQGIKNQWQGDPNSQGINDISFTLQ
MLDHFEDRYCIDRTRVYAAGKSNGGGLTNLLACDPTASKRFAAFAPVAGAYYQNVTEDNC
RPNTVKIQCNPGRTPIPMLAFHGTADETIQYTGGGRRGKCLPSVPHFVREWAGRDDLGGK
NETTTTDGGKVEVSRFGDHGEVVHYRIEGLGHAWPSTEPNSDNPDGTYMDATPLIMGFFD
QWTL

Enzyme Prediction     

EC	3.1.1.72:1	3.2.1.8:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	41	186	1.9e-21	0.6079295154185022

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	1.10e-38	40	301	43	306	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
273828	esterase_phb	1.07e-11	46	209	1	182	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
224423	DAP2	2.50e-06	35	207	369	563	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
402228	Esterase_phd	1.22e-05	59	209	15	183	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
223489	DLH	0.007	122	206	100	169	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO15718.1|CE0	6.88e-33	39	304	30	291
ASY31590.1|CBM13|CE0	1.05e-24	30	299	175	448
UKZ97189.1|CBM1|CE0	2.84e-24	15	221	48	229
CCA72326.1|CBM1|CE0	3.30e-24	13	214	21	195
AXF48684.1|CBM1|CE0	6.81e-24	15	249	90	323

PDB Hits     

ASPGLDRAFT_129062-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CC33|FAEC2_ASPCL	2.25e-18	7	214	18	200	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1
sp|Q9Y871|FAEB_PIREQ	1.05e-17	44	273	292	519	Feruloyl esterase B OS=Piromyces equi OX=99929 GN=ESTA PE=2 SV=1
sp|B8N7Z6|FAEC_ASPFN	3.88e-17	1	245	10	229	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1
sp|A2QYU7|FAEC_ASPNC	5.33e-17	1	214	10	198	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q2UI81|FAEC_ASPOR	1.01e-16	1	245	10	229	Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=faeC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.884298	0.115722

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_129062-t33_1-p1.