CAZyme Information: ASPGLDRAFT_127392-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_127392-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428	KV878898|CGC2	47325.48	9.6410

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878898:688822-690231(-)

Full Sequence      

MAVSIFTSPPLIITLSLALRATLLIYGFWQDAVSPVKYTDIDYLVFTDAARYVSQGLSPY
SRDTYRYTPLLAWLLVPTTWNVAGFSLFSFGKVLFAAADVVAGWLVAKCLRTHYGMDTGR
AMKFACVWLLNPMVANISTRGSSEGLLGVLVAGVLWAALSRRVVVAGVLLGVGVHFKIYP
FVYGVSILWWLGASTSSKDSDNDKGSNGKEKTTLQSITGFITHSRILLTLTALTTFLALN
ITMYTLYGTPFLQHTYLHHLTRIDHRHNFSPYSTLLYLASVDGGHGYGYRFESLAFIPQI
LLSVAVIPVVLAKRDLAGAMLAQTFAFVGFNKVCTSQYFLWYLIFLPFYLPNSSLLRKPR
LGLSVAALWVIAQALWLHQGFRLEFLGVSSFVPGLFLAGLFFYVVNCWILGILVQDVGGL
SAQEQVAK

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	137	413	4.4e-92	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	6.75e-77	16	415	15	416	GPI mannosyltransferase
252941	Mannosyl_trans	5.36e-62	137	414	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR91806.1|GT50	2.24e-280	1	428	1	426
BCS05340.1|GT50	9.43e-200	4	421	10	423
BCS16894.1|GT50	9.43e-200	4	421	10	423
EAA63338.1|GT50	1.29e-197	4	424	3	435
UDD65877.1|GT50	1.81e-195	4	417	3	410

PDB Hits     

ASPGLDRAFT_127392-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WAH2|GPI14_ASPFU	1.27e-200	4	419	3	423	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	2.28e-198	4	424	3	435	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	3.22e-196	4	417	3	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q7S4Z3|GPI14_NEUCR	4.83e-162	4	418	21	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.61e-159	7	426	10	417	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.983961	0.016065

TMHMM  Annotations     

Start	End
7	29
85	107
141	160
170	192
226	248
295	312
324	346
361	378
391	413