CAZyme Information: ASPGLDRAFT_125325-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_125325-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	KV878896|CGC2	27455.64	6.8468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878896:52822-53705(+)

Full Sequence      

MKLFLLTLPVLAQCGEIVWNGRIDASTTVDHFDQWSWSNQIKPYQWYIHGDGKTSRYLGL
STDFKNPASDDGKGMKISIDQSSSWNGQPMLRSELIPQTTEDLGSGRLIYHFSLQTRKKN
APQGDVEHQIAFFESHFTELKYTGNTLQWMADGKSQWSTKLQPGTWHNFAYDIDFDKQTV
GLWASNGAQPLKKVVDNVSVSASSNSQDWHVGELKAEKSGGREDWYWSGVYIEKAPVTRK
IS

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_125325-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	17	241	8.4e-88	0.984313725490196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.39e-70	17	238	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR87405.1|GH131	2.32e-173	1	242	1	242
QMW42809.1|GH131	1.12e-113	1	242	1	246
QRD89644.1|GH131	1.12e-113	1	242	1	246
QMW30756.1|GH131	1.12e-113	1	242	1	246
UDD59586.1|GH131	1.12e-113	1	242	1	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W9A_A	4.57e-84	15	241	1	231	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]
4LE3_A	8.17e-79	15	242	1	241	Chain A, Beta-glucanase [Podospora anserina],4LE3_B Chain B, Beta-glucanase [Podospora anserina],4LE3_C Chain C, Beta-glucanase [Podospora anserina],4LE3_D Chain D, Beta-glucanase [Podospora anserina],4LE4_A Chain A, Beta-glucanase [Podospora anserina],4LE4_B Chain B, Beta-glucanase [Podospora anserina],4LE4_C Chain C, Beta-glucanase [Podospora anserina],4LE4_D Chain D, Beta-glucanase [Podospora anserina]

Swiss-Prot Hits     

ASPGLDRAFT_125325-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999741	CS pos: 14-15. Pr: 0.9655

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_125325-t33_1-p1.