CAZyme Information: ASPGLDRAFT_124657-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_124657-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		45587.18	4.1597

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878895:608602-609912(+)

Full Sequence      

MSISRFATLGALVSLAAAWLPETNKQITANNGTNLFSKSNGKIRGVNTGSQFIFEPWIGE
SAWSDMGCGGQKSEFDCVSSLGQDKANSAFAKHWDTWITEEDISEIQNYGLNTIRIPVGY
WMKEDLVYRDSEYFPQGGFDYLERLCGWASDAGLYIIMDLHGLPGAQTPENPFTGQYASE
AGFYEDYQYERALKFLEWMTTNIHQNDNFRNVGMLEIVNEPEQEEDKAASVRAGYYPNAY
RRIRAAEQKLSINRNDYLHIQMMDETWGAGNPNQYLDDLYYAAYDDHRYLKWANIDASHD
SYISTSCSDDLDSNTPLIVGEWSLAVADDIESDPNWDPDSNTEFYKKWFAAQITAYERQQ
GWVFWTWKAQLGDYRWSYQDAVSAGVIPTDLNSALDMGACG

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	82	379	9.1e-146	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.36e-22	42	380	17	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.57e-10	95	369	22	270	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89699.1|GH5_15	5.22e-284	1	401	1	419
QMW47496.1|GH5_15	1.16e-203	1	400	1	401
QRD91854.1|GH5_15	1.16e-203	1	400	1	401
BAE65206.1|GH5_15	1.16e-203	1	400	1	401
QMW35434.1|GH5_15	1.16e-203	1	400	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.96e-34	40	401	6	392	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	7.18e-34	40	401	6	392	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	7.94e-34	40	401	12	398	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	7.94e-34	40	401	12	398	Chain A, Hypothetical protein XOG1 [Candida albicans]
3O6A_A	1.08e-33	40	401	11	397	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DGM6|EXGB_NEOFI	2.81e-240	3	401	2	400	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	6.07e-227	3	379	2	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	7.07e-226	3	379	2	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	1.10e-224	11	400	13	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	2.05e-204	1	400	1	401	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999707	CS pos: 18-19. Pr: 0.9629

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_124657-t33_1-p1.