CAZyme Information: ASPGLDRAFT_1212441-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_1212441-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602	KV878935|CGC1	66600.84	6.5481

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878935:57344-59416(-)

Full Sequence      

MGNIKLLNQSEFYLSSIMSKGSVKNITVPELANEFDFIVVGGGTAGNVVAGRLAENPKVS
VLVIEAGRGDPENIGEITTPARAFECRNGPHDWKYKATMIDREDYTRVEKPNTRGKVLGG
SSCLNYYTWVRGSKATFDDWEEFGGSGWNWEGVKEYFDKPVTYHDDNNNYPHVRNIGLGG
PLHIGHADLVPELQPFRDALLKAWQSKGLKVNDDIYSGYVSGLTHCATSIYKGVRSSSWS
FLVGKPNIQILSSSYGKRLIINDNCATGVDVRGPNDENITIKARKEVIVAGGVYESPKLL
MLSGIGPEKELAQFAIKVTVDSPHVGQNLVDHPILSHVFRLKDGLGLDDHLLRAGPQKEG
AVMAYNRNHTGALASGLLELVGFPRIDDRLNKIQAYVKAKQENGGKDPFGPAGQPHFEID
FVPMFADAFQWHFPIPPEGTWLTTIVDLLRPMSKPGWVKLQSANPLDHPHINVNFFENHL
DVIALREGVRFVDDILMTGEGLRDIIGEDYPWPMPRNSDEAMDKMVLERAQIGFHPCGTC
RLSKDIKQGVVDGGLKVHGLKNVRVIDASVFPVIPDCRIQNPVYMVGEKGADLIKADHKD
LY

Enzyme Prediction     

No EC number prediction in ASPGLDRAFT_1212441-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	34	597	2.2e-150	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.29e-91	33	595	4	532	choline dehydrogenase; Validated
225186	BetA	5.38e-91	30	599	3	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.52e-40	456	589	5	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.48e-28	114	334	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.80e-27	33	587	54	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR84705.1|AA3_2	0.0	43	602	12	571
AEO67525.1|AA3_2	1.02e-294	34	602	10	579
ATZ50069.1|AA3_2	2.20e-293	33	602	7	577
BCS02092.1|AA3_2	2.37e-293	26	602	1	578
BCS13779.1|AA3_2	2.37e-293	26	602	1	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.56e-253	33	602	5	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.45e-253	33	602	5	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.27e-252	33	602	5	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	9.50e-73	34	597	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.15e-72	34	597	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	1.83e-65	32	594	4	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q1BQE2|BETA_BURCA	2.22e-62	34	595	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) OX=331271 GN=betA PE=3 SV=1
sp|B1K707|BETA_BURCC	2.22e-62	34	595	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) OX=406425 GN=betA PE=3 SV=1
sp|A0B2F7|BETA_BURCH	2.22e-62	34	595	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) OX=331272 GN=betA PE=3 SV=1
sp|A4JJG6|BETA_BURVG	8.28e-62	34	595	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_1212441-t33_1-p1.