CAZyme Information: ASPGLDRAFT_118909-t33_1-p1

Basic Information

• Species: Aspergillus glaucus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus glaucus
• CAZyme ID: ASPGLDRAFT_118909-t33_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		44748.17	4.9713

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AglaucusCBS516.65	11429	1160497	175	11254

• Gene Location: location=KV878890:1144475-1145970(+)

Full Sequence      

MLQTSIIGILYALSLWSATNAENITSDSYFYGQSPPVYPSPEGTGSGSWATAYRKARDLV
EKLSPEEKVSLTAGVKLDDGCMGNIPAIPRVGFLGLCESDAENGLRMTDYVNGWSSGIHV
GASWSKDLTRQRGMHMGQEFRNKGVHVLLGPVVGPIGRVATGGRNWEGFSSDPYLTGELG
AETVKGIQSAGVSASTKAGHYIGNEQELHRNPETDAQGENVESVSSNIDDTTIHELYLWP
FQDAVRAGNASVMCSYQRINNSYGCQNSKTLNSLLKGELGFQGYVITDWYAQHAGIVAAN
AGLDMVMPITTLWGLNLTDAIANGTMDASRLDDMVTRIIASWYQLGQDTSFPPTGIGMPH
DVNANHQRIIAKYPAERETLLQSAIEGHVLVKNVEGALPLQTPQLLSVFGYDAR

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	88	308	4.6e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.37e-44	99	382	66	342	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	7.46e-31	100	339	73	314	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	4.83e-18	122	410	128	417	beta-glucosidase BglX.
178629	PLN03080	6.51e-08	163	408	167	423	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR91138.1|GH3	2.18e-213	1	414	1	412
ANT73245.1|GH3	2.64e-206	4	414	5	412
CAK48253.1|GH3	2.64e-206	4	414	5	412
BAE60358.1|GH3	4.72e-205	8	414	9	413
QMW30621.1|GH3	4.72e-205	8	414	9	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FJJ_A	2.88e-114	34	413	7	407	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
4IIB_A	2.54e-111	34	413	6	406	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5JU6_A	7.11e-111	12	413	10	421	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
6SZ6_A	6.80e-110	34	413	4	401	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJI_A	1.72e-108	34	413	6	407	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5ABF5|BGLM_ASPNC	4.70e-207	4	414	5	412	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1
sp|Q2UDK7|BGLM_ASPOR	8.38e-206	8	414	9	413	Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglM PE=3 SV=1
sp|B8N5S6|BGLM_ASPFN	8.38e-206	8	414	9	413	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1
sp|Q0C7L4|BGLM_ASPTN	1.71e-203	6	414	7	429	Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglM PE=3 SV=1
sp|Q4WR62|BGLM_ASPFU	8.92e-198	17	414	22	416	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000455	0.999526	CS pos: 21-22. Pr: 0.9755

TMHMM  Annotations     

There is no transmembrane helices in ASPGLDRAFT_118909-t33_1-p1.