CAZyme Information: ASPFODRAFT_87654-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_87654-t33_1-p1
• CAZy Family: GT69
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	KV878237|CGC1	27386.00	4.2195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878237:2612948-2613703(-)

Full Sequence      

SIPHKLWQKTGTKGLTSQAESWISTWTTLNPHLRHEILTETSSLAYVETNFRPIWPEIAD
LYTSLSVPILRADLLRLLILYIDGGIWSDLDVSCEVPISQWPIPPTANVVVGIEFDGWQF
ASWTVMSTPGNGHIYHAIEYVAGRLEGLARENNVTVGEVTMEMIPDVVDVTGPQAITVAL
LETISEEVGRGVGKEEIEGIGEGGVLLGDVLVLPQASFAALQGGMPQGQGEYLVSHHYAG
SWKNEVGGEEGV

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_87654-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	102	1.6e-17	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.42e-16	2	130	82	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.98e-11	20	103	9	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40793.1|GT32	1.29e-167	1	252	102	353
BCS30122.1|GT32	1.50e-90	2	251	111	365
EAA62114.1|GT32	7.79e-90	1	251	111	366
QQK40626.1|GT32	3.65e-85	1	249	92	341
CAP80736.1|GT32	3.36e-83	1	249	92	341

PDB Hits     

ASPFODRAFT_87654-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.19e-17	2	245	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.57e-10	2	245	99	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	5.33e-10	2	244	130	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.47e-09	2	131	96	272	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999822	0.000194

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_87654-t33_1-p1.