CAZyme Information: ASPFODRAFT_83705-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_83705-t33_1-p1
• CAZy Family: GT66
• CAZyme Description: glycosyltransferase family 25 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	KV878246|CGC6	72665.40	6.8768

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878246:637987-641951(-)

Full Sequence      

MAIEILPLTKEDIPSAVACIQKAFADDPYFHWVFNNKSGFNIHRNAASLAAHFLYGLSCN
EPIFVAKYTTNTPRDKIPTDSPVVGVCWWYSPQPPSEPVPWSVWAQDWILSFRQLYNNIR
FGGRGGLNVRRYWLWKARQQETHDRVWTDPRGYYFCNVIAVDSSMRGMGLGRKLVEVVSQ
QADREGMPCYLESSKGFPNLMIYEKLGFEMVSEIECVDGKDKCKRRHEKAQEVCSLRYAR
YFTLFNVVSHFIDHLQLAPVLSMIRGKSRFTKYIVAAFASYIILTLLFSGTGEKYWKQDW
VKIARSTLEDRALEHIQNETLGFEHIYAIGLKERTDKRDFLNLAASIAGFRVEWVDGVHP
EDMSEKALLNDNLLAPSEIGCWRAHMNALSNMVQNSYSTALILEDDADWDVSIRQQLREF
ARGVRALTRNANTTKSAPYGTNWDILWVGGCASSAAPNETQFYAIPNDPTVPSVDHRGTW
GGPLDSWKEIYPETSTRFIYRADMGCCTYGYAVTKRGAERILAALAVDRLVAAVDNSMAD
MCGGKDGRSQIECYAPFPNIIGTYKAAGLASKDSDIREGSDEWHEAQAWNLMYSTRLNIH
RLVAGRDTVHAQYDEGFPWSRRVLDWKEFEYPRGYLVS

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_83705-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	323	538	4.4e-33	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	2.85e-18	325	410	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	6.79e-08	322	560	1	206	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
404402	Acetyltransf_7	1.15e-06	145	209	19	82	Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.
366794	Glyco_transf_25	9.80e-06	323	538	1	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
178308	PLN02706	1.10e-04	159	208	91	139	glucosamine 6-phosphate N-acetyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38229.1|GT25	0.0	1	638	1	688
BCR98565.1|GT25	6.87e-313	224	638	4	418
BCS10899.1|GT25	1.33e-283	263	638	1	376
CAP93867.1|GT25	5.35e-161	262	635	3	382
CAP98036.1|GT25	1.19e-155	275	638	13	389

PDB Hits     

ASPFODRAFT_83705-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPFODRAFT_83705-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_83705-t33_1-p1.