CAZyme Information: ASPFODRAFT_703889-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_703889-t33_1-p1
• CAZy Family: GT39
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853		92434.57	4.9657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878251:824302-826892(+)

Full Sequence      

MPQEERASSHVRQLLQSLALEEKVALLAGKNMWETVNIDRLHIPSLKMTDGPAGARGSKW
TYGSLTTWIPCGISLAATFDPAMVEQVGRVLGQEARRKGCQVLLAPTMNLSRSPLGGRNF
ESYGEDPYLVGVTATVMIRGIQAQGVGACMKHFILDDTETRRFNVDQTIDERTLREVYMK
PTPWTAMVSYPKINGLHADISPHILPRLLRQELQFDRLVMSDWGGLNSTADSLRATTDLE
MPGPAVRRGERLLAAIRAGEGEVAAHVDPSVRRFLQLLECTGLLGDATEATEHSEAATDD
PIFHRIARDAAQSGLVLLKNDKAILPLKPTTLQRVAIIGPNARQPTAGGAGSAAVNPFYV
STPEACLRDALHAANAELQVSYEQGIPSSLRPPLLGKLLTVPDGSRSGWQVSFFEGHALE
GPVVASSMWDDSLIYLFSDGDVPAVLDDRPYSYRATGVVTPQESGRYTWSLANTGKAKLF
VDDELLIDNTEWTGLTGGFLGCSSADKTASVYLEAGRAYQLRVDNVVTLPVVEAFDNTLF
PRISGIRVGLALEQDEQEMLAQAVAAARQADVAVVVVGHNKDSEGEGGDRATMQLPGRTD
EMVSAVCAANPNTVVVVQSASAVAMPWVDAASGLVMAWYQGQENGHALAAALLGDCDFSG
RLPITFPRRLEEHGSNAWFPGEAAQDRNTFGEGVRVGYRHFDAQGIPALWPFGFGLSYTR
FQLTDIRVCGRVEGRSRESQFALIQARVCNVGGRDGQEVVQVYVAPSAQIREAGEMSFPK
TLAGFCKIAVPAGVSREVSIPIRGSELSWYDARVAQWRLDAGKYACWVGRSSSQIDAELE
IEVAEGDDIDMGH

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_703889-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	242	7.8e-56	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	8.36e-66	30	348	47	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.00e-43	40	832	101	754	beta-glucosidase BglX.
395747	Glyco_hydro_3	2.83e-36	40	277	63	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	3.90e-27	315	718	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	8.92e-23	1	351	47	439	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13433.1|GH3	0.0	1	853	1	863
BCS01725.1|GH3	0.0	1	853	37	899
CAK48047.1|GH3	0.0	1	852	1	862
QMW31943.1|GH3	0.0	9	843	7	851
QRD91011.1|GH3	0.0	9	843	9	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.16e-140	11	843	6	836	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.31e-135	11	843	6	836	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.28e-103	11	843	5	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	4.90e-98	8	843	51	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	6.31e-83	15	847	9	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	7.17e-164	11	843	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	1.37e-157	9	841	9	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	4.19e-150	11	842	6	831	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.64e-149	11	842	6	831	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WLY1|BGLJ_ASPFU	5.08e-148	11	844	14	859	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_703889-t33_1-p1.