CAZyme Information: ASPFODRAFT_65827-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_65827-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	KV878254|CGC4	46376.01	7.0003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878254:144131-145515(+)

Full Sequence      

MVWRYILRRPVLGALCFLVLFTWLLQQPDTSVKQISLLQHRYPLLFERVHTNTRNGGAWY
IPPTWTNETEQHPENIVDAAERVLRLAQTTERQIPHSSIPLIVHQTWKSTRVDTWPHVLQ
QSTEKWLRAVDEQMAYFLWDDDGIRQFIRRFEPEREKQFYALPSHVERSDVFRILVCKWI
GGVYADIDTEPLQSPTYWIAETDILPWEDRETGRVYNSTGSVHAIVGLEADCPPNSDTYW
RMGYLLPVQLTQWAFAWAPGHPILQIFLDRLFMEPALQPHSSVLNALDPLALTGPVAFTH
AVQNWLEAVVGLRWNALSGLHDGGESKLVEDVLILPITGFSPGRGKYGNMGSKPISDPSA
RLYHHAQGSWREFNLRVEYGKFCRTVFGRCRTWSKVPQGLLL

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_65827-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.17e-17	96	276	79	248	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.17e-11	116	203	1	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44893.1|GT32	4.90e-210	1	334	1	344
BCR93027.1|GT32	8.05e-180	7	397	6	408
BCS05686.1|GT32	8.05e-180	7	397	6	408
CAK38082.1|GT32	1.62e-179	7	397	6	408
ADK37855.1|GT32	1.25e-174	7	375	6	385

PDB Hits     

ASPFODRAFT_65827-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.22e-29	89	372	131	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.41e-20	86	372	83	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	2.20e-17	96	341	127	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.57e-12	99	372	96	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.84e-10	97	202	55	162	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999474	0.000538

TMHMM  Annotations     

Start	End
5	27