CAZyme Information: ASPFODRAFT_63578-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_63578-t33_1-p1
• CAZy Family: GT31
• CAZyme Description: carbohydrate esterase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296		32512.17	4.2638

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878246:1150469-1151727(+)

Full Sequence      

MTAIPTATARPWTQVPRPRAENTTTTNPTYFFTFGDSYSQTGFSASGTQPSASNPMGNPD
LGIGTTTNGPNWIGYLTTTENASLVLNYNFAAGGATIDNALVPAYPGDLASQFRLFEDVY
AQKPETAPWDAKDAVFGVWIGINDIGNAYYSTDAATYTPKLISRLESLVEEVYKNGGRKF
LFLNVPPTSRSPLFLDQGEEVAKQHAEYLAVFNENLEGMVEKFDKEKGDVTTVLYDSWSF
MTKILDDPTAYGFPNATCIDDDGTSCIWWNNYHPGMKYHLLQAEDMKGVMGGLGGW

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_63578-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	31	286	4.8e-109	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	9.83e-67	30	286	1	267	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.37e-30	89	274	79	299	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.70e-13	32	284	2	222	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	1.51e-08	34	286	35	329	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
178701	PLN03156	3.14e-08	133	277	158	333	GDSL esterase/lipase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR94351.1|CE16	1.20e-219	1	296	16	310
ULM60884.1|CE16	5.69e-198	1	296	1	293
BCS06955.1|CE16	7.78e-176	60	296	2	238
CAK45102.1|CE16	1.89e-165	1	296	1	317
QMW25447.1|CE16	9.15e-143	3	296	12	298

PDB Hits     

ASPFODRAFT_63578-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	3.77e-68	30	284	33	291	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	1.07e-67	30	284	33	291	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|Q9SYF0|GLIP2_ARATH	9.41e-09	89	253	118	298	GDSL esterase/lipase 2 OS=Arabidopsis thaliana OX=3702 GN=GLIP2 PE=2 SV=1
sp|Q9SYF5|GLIP3_ARATH	5.32e-08	81	253	99	287	GDSL esterase/lipase 3 OS=Arabidopsis thaliana OX=3702 GN=GLIP3 PE=2 SV=2
sp|Q9FXB6|LIP4_ARATH	1.30e-07	32	264	42	311	GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana OX=3702 GN=LIP4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.941270	0.058757

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_63578-t33_1-p1.