CAZyme Information: ASPFODRAFT_63340-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_63340-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: glycosyltransferase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	KV878246|CGC7	55080.46	6.1018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878246:356165-357662(-)

Full Sequence      

MGREPVPRRRPYWAIPSRKVTNILALILFVVVAASVFKLEIGAPPFDPTSLYRHHSHPGE
PDFWEWETTSRFPHVQNPVKNDDQLCDLFPAYLLSRVQVVLKIGASEPADRVNAQISSVT
RCIPNIIIVSDRESQIKEHRVHDILAALPESFRANTSDFEAYDALQRGDDKIVAAPQGWR
LDRFKFLPMVERAHEINPSADWFVFLESDTYVVWDNMFRFLDQFDPHTPLYMGSPSPGRR
INDKEVSYFAYGGSGFVLSTAAVDKLVYREVGSHGEYIQPTLSEQYEDIVKADCCGDSIL
GWALHEKGVELSGFWPMFNPHPLHGIPFDDAYWCQPVISMHKTLLPDMTGLMRWENQRDR
TRPLIYADLMEYLKLGTVDHMSDWDNGDWGGWQEPPESPAHGSFEACQTACHEHAQCLSF
TYDSSGHCVFVRTMRLGAKKKLGDSSVRLSSGWDLEKIKNWRASHQCEKVMWMKPSTERI
F

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_63340-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	4.64e-08	196	274	81	167	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	4.69e-04	198	259	209	270	hypothetical protein; Provisional
394981	PAN_1	0.004	394	430	15	52	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10791.1|GT31	0.0	1	481	1	481
BCR98451.1|GT31	0.0	1	481	1	481
CAK49077.1|GT31	0.0	1	467	1	467
UDD57328.1|GT31	5.04e-250	15	481	5	477
QRD83812.1|GT31	7.16e-250	15	481	5	477

PDB Hits     

ASPFODRAFT_63340-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPFODRAFT_63340-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999974	0.000011

TMHMM  Annotations     

Start	End
20	37