CAZyme Information: ASPFODRAFT_53071-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_53071-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	KV878254|CGC4	51683.78	5.3057

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878254:41975-43360(-)

Full Sequence      

MALVSGRALRGELIWSDRLALAHKHSGPQQRVFFSARPPNPSSLIPLMGQLGQSVTMQLK
TPIPAMPAMPAMSGVCLPRQVRRVVPLFLAVFCLVFYLSLTGTFAEFHGSLARQSKCRLF
PRKIWQSWKVNPFEFEERDLNVARTWTSINPGYRYEVLTDQNDLHYVETNFGPDGLNRPD
IVETYRSLTAKIIKADLLRYLVMYVDGGVYADIDVEALRPLDRFIPERFNEADMDLVIGV
EIDEPDFNDHAILGPKSQSFCQWTFISKPRQPVMMRLVNRILEWLHDHSVKQGKPISDLE
LDFDDIISGTGPSAFTEAVLAEMSARTGQEVTWKTFHDIPESKLVGGILVLTVEAFAAGQ
GHSDSGNHNARSALVKHHYHASGWPNTHPRFKHPLYGEVEQCNWNKQCVADWDANTAAFA
ALSPEEQEQQIAMKQAADAAEAEMAVEDLAGDDEDLGLALE

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_53071-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	141	227	4.3e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.38e-23	120	285	82	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.27e-15	137	227	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05523.1|GT32	0.0	1	461	55	515
BCS17076.1|GT32	3.83e-305	48	461	1	414
CAK96510.1|GT32	1.51e-289	57	461	1	408
QMW40889.1|GT32	1.05e-220	72	439	1	370
BAE58544.1|GT32	1.05e-220	72	439	1	370

PDB Hits     

ASPFODRAFT_53071-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.54e-36	121	384	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	8.29e-32	120	382	99	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	9.23e-31	120	356	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.48e-22	121	382	97	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	4.34e-09	121	225	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

Start	End
84	106