CAZyme Information: ASPFODRAFT_52734-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_52734-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		91427.11	8.2749

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878252:612130-615024(+)

Full Sequence      

MEKDPRLGHSNPGTSSYDQAPPPYSPYTDGGLVVESADVQANGRVNVDLDSSLARTLASI
VELQQEDLQNPPPGYSEAQPVNDELLQPDIQLNIVIQIVGSRGDVQPFIALGTELQKYGH
RVRIATHDVFSGFVTQSGLEFYPIGGDPAELMAFMVKNPGLIPQISSLRAGEVQKKRAMV
NEMLHGCWKSCIEDDPVTKIPFVADSIIANPPSFAHVHCAQALSIPVHLMFTMPWTSTKA
FPHPLANLSSSDMNPNVANWVSYGVVEWLTWQGVGDVINRWRASIDLEPVPTTEGPRLAE
TLKIPFTYCWSPALIPRPRDWPANIDVCGFIFRDMPSYEPPPDLKEFLRSGATPVYIGFG
SIVIDDPQKMTEIILEAIARTGVRAIISRGWSRLGGMPSSNVYYIDDCPHEWLFKHVAAV
VHHGGAGTTACGLANGRPTTIVPFFGDQPFWGSMVARSGAGARPIPYASLNAENLAEAIA
FSLRPAAADSARDIALKMQHESGVAAAVRSFHRHLPLNRMRCSLIPNQPATWTYKRSKNS
IGLSKVAVQLLIDNGKINARELRGNAINPIHIENRRWDPVTGILSASTSTGSAMLKSTGE
MLYNPYKEYTSSRSPKPPISRSGSALSTTTTSSSSRSLTSLAEASRRPSELMHTDTPIND
GPNKHALSTAGSMVGASLKGFGKFTGAYFKGVVVDIPYAAAEGFRQVPRLYGEEPKQYGT
VRDWKSGATMGGKNFVDGMTDGFKGFFYQPIKGAREEGALGAVKGFAKGTIGLATKVPSA
GIGLVAYPFQGITKTIEAAVRSKTGKTILLARLRDGYAMTERAHMSEDEEQYLLRRFQAL
AG

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	119	514	5.3e-52	0.9659685863874345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.14e-81	92	514	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.07e-47	94	513	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	6.70e-24	94	242	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	1.27e-07	682	796	2306	2413	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].
273616	MGT	1.28e-07	103	479	7	353	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15859.1|GT1	0.0	1	842	1	842
BCS04269.1|GT1	0.0	1	842	1	842
CAK48301.1|GT1	0.0	1	840	1	840
CAP79869.1|GT1	0.0	20	837	18	837
BCS26658.1|GT1	0.0	19	840	23	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	5.81e-74	86	519	14	443	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	9.77e-74	86	519	34	463	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.61e-28	92	507	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	8.11e-28	92	507	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	2.95e-23	92	507	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	1.87e-132	92	523	193	618	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	2.95e-131	91	516	155	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	1.46e-78	73	518	1148	1612	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q5A950|ATG26_CANAL	1.06e-76	77	519	1000	1437	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2
sp|Q4WID6|ATG26_ASPFU	5.15e-76	76	515	880	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_52734-t33_1-p1.