CAZyme Information: ASPFODRAFT_51656-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_51656-t33_1-p1
• CAZy Family: GH92
• CAZyme Description: carbohydrate esterase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		39873.47	4.8835

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878249:723797-725009(-)

Full Sequence      

MRLPRCVSVILLGLEAALAESTQKWSIQDFKTLVSFGDSYTDDTRISYFSNHNGSAPPVG
WVEPITNQSASGGYIWGHFVHQYAHLSHRYNYAVSGASCSNKITPRTTSFGLYPSVLEYE
VPAFTADNAYHIPSTGEKFLQNDPDSTIYSIWIGTNDLGNYAFLTDSQVANKTIPDYVDC
VFNALDGVYKAAKGKYFVIMNMVPLQLAPLYATPENGGIGANNYWPDKSGNFTEISYRMW
EQVSTVNQVYDYRTPFEWVVGKRYPGAKVAVMDMYSLISDIYYHPQQYLNGSAPANVTGY
IHHCNVAGSECETLSSPDSFLWYDQLHPSQRTDEIIAEEFIKVVKGESEYATYWS

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_51656-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	33	340	9.9e-70	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	8.18e-48	32	340	1	267	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.66e-11	91	341	79	312	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.54e-09	33	340	1	224	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	3.91e-09	7	338	11	327	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	1.95e-06	30	338	1	275	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15697.1|CE16	1.13e-273	1	355	1	355
BCS04097.1|CE16	1.13e-273	1	355	1	355
QMW44554.1|CE16	1.56e-155	4	354	5	353
QRD84022.1|CE16	1.56e-155	4	354	5	353
BAE62044.1|CE16	1.56e-155	4	354	5	353

PDB Hits     

ASPFODRAFT_51656-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	3.87e-84	29	354	26	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999733	CS pos: 19-20. Pr: 0.9815

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_51656-t33_1-p1.