CAZyme Information: ASPFODRAFT_50749-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_50749-t33_1-p1
• CAZy Family: GH81
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	KV878247|CGC12	92411.83	5.3719

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878247:991168-993886(+)

Full Sequence      

MPCVHAAAETDKSFVQIANADIEELIKQLTLDEKVALLTGDDFWHTVPIPRLGIPSIRLS
DGPNGVRGTRFFGSVPAACLPCGTAIGATFDENLAVQVGHLLAAEAKAKGTHVVLGPTIN
IQRGPLGGRGFESFSEDPLLSGTIAGHYCKGLKEENIIATLKHFVCNDQEHERMAVNSIL
TDRALREIYLLPFMIAISLGKPEAIMTAYNKVNGLHASESPTLLQDILREEWGWEGLLMS
DWFGTYSTSEAVNAGLDLEMPGPTRWRGSALSHAITANKIPMATVNARVRAVLRLVQQAS
RSGIPERAPELQLNRAEDRRLLRKIASEAVVLLKNDDGILPLDKTKKVAVIGPNSKIATY
CGGGSAALNPYQAVTPFEGISNSASGGVEFAQGIYGHQNQPLLGMRLRTQDGRTGFTLKI
FNDPPTVANRVPLEERHETDSMVFFLDYNHPELQPVWFADAEGYFVPEESGLYDFGLCVQ
GTGKLYVDGNLLVNNADVQRPGSSFLGSGTMEERGTLELTAGRQYKIHVQWGCAKTSTFK
VPGVVDFGHGGFRFGACKQLSPSKGIEEAVQLAASVDQVILVAGLSAEWESEGEDRTSMS
LPPHTDELISRVLEVNPDTVVVLQSGTPVEMPWIQKAKAVLHAWYGGNETGNGLADVIFG
DVNPSGKLPLTFPRHVKHNPTYFNYRSEGGRVLYGEDVYVGYRFYDEAEVDPLFPFGHGL
SYTTFELSGLSLKREACSLQATCTLRNTGSRAGAEVIQLYVTPVSPPIKRPLKELKGFRK
VWLEPGEEEVVQIPLDLVRATSFWDEKSNSWCSHSGTYQIMLGSSSRGTFLEDSIELSET
TFWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	49	261	6.8e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.65e-97	19	827	35	755	beta-glucosidase BglX.
224389	BglX	2.34e-75	42	383	48	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.37e-60	330	722	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.39e-47	25	832	56	778	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.05e-41	47	295	59	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12335.1|GH3	0.0	1	846	1	846
BCS00565.1|GH3	0.0	1	846	1	846
CAK49185.1|GH3	0.0	1	846	1	846
QMW48789.1|GH3	0.0	14	845	15	847
UDD66060.1|GH3	0.0	14	845	15	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.71e-259	21	846	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.54e-254	21	846	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.63e-154	21	840	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.75e-116	26	827	9	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.87e-114	24	826	56	817	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BB53|BGLI_EMENI	0.0	21	846	5	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|B0Y8M8|BGLJ_ASPFC	0.0	22	846	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q4WLY1|BGLJ_ASPFU	0.0	22	846	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B8NDE2|BGLI_ASPFN	0.0	21	846	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	0.0	21	846	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_50749-t33_1-p1.