CAZyme Information: ASPFODRAFT_50512-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_50512-t33_1-p1
• CAZy Family: GH78
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	KV878247|CGC2	45673.72	4.4068

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878247:474302-475835(+)

Full Sequence      

MALIVLKVLFLASLIIPSIALSDQARNGNARTKCEVKPGGSSEIDDVPAILDALTTCGSG
GRVTFTNHTYYINSVMNTTWLDDVEIDLQGTLLWSTNISYWLNHSLPVGYQNQSTAWILG
GKDIVFEGHGYGTFNGSGPTWYKYVGSTSNYPRRPNQLTVSGATGAVFKGLRFVQSQMWT
MSIIYTSDSVFDSIYVNNLYDDGDSAQNTDGANTIYSNNITFTNWEVVNGDDSISTKANS
TDITIANSKFTSGLGIAIGSIGQYNGAFETVKGLRISNITYDKTTHAVYFKTWTGDQVGY
PPNGGGGGLGYASDIVATNLKTNNLKGAPFTISQCTTFSGASGNCTNSKFQIRDLVFTDI
SGTVDSAEVASFQCSAVAPCEDITIENVSLRIAGNTTLADEYLCGNVEGAVGWNCTGEVC
VGSSATGGC

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_50512-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	77	410	6.1e-58	0.8861538461538462

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.37e-22	82	390	24	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	2.59e-21	40	391	77	409	polygalacturonase ADPG
215120	PLN02188	9.41e-21	3	391	6	375	polygalacturonase/glycoside hydrolase family protein
215540	PLN03010	1.09e-16	40	426	56	408	polygalacturonase
215426	PLN02793	1.19e-16	130	390	149	394	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38178.1|GH28	1.36e-288	1	429	35	463
ABD61567.1|GH28	1.36e-288	1	429	35	463
BCS12167.1|GH28	1.72e-262	76	429	1	354
BCS00389.1|GH28	1.72e-262	76	429	1	354
QRD90865.1|GH28	4.05e-172	30	429	19	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.95e-32	29	416	14	383	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	2.24e-08	82	397	41	338	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	6.74e-290	1	429	1	429	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|Q2EQQ2|RGXA_ASPNG	4.15e-71	12	408	13	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	8.20e-71	11	408	12	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|B8NJB0|RGXA_ASPFN	8.51e-66	34	415	31	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	8.51e-66	34	415	31	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999781	CS pos: 20-21. Pr: 0.9881

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_50512-t33_1-p1.