CAZyme Information: ASPFODRAFT_48741-t33_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: ASPFODRAFT_48741-t33_1-p1
• CAZy Family: GH75
• CAZyme Description: glycoside hydrolase family 105 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	KV878244|CGC8	47084.94	4.0885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisCBS106.47	13784	1137211	282	13502

• Gene Location: location=KV878244:1342782-1344275(+)

Full Sequence      

MTQSFLSFTAALLTGLLSHSQPAAAVGISCDPDTRPYSAWMTDSVIARRDAILGDFTPGD
DIYPNISQVTLFESTVTRLKEYYDADSCGQVDWHSYALDGAESLLPAVQDVSFIVNAPLT
IFASGDVMYHQYDRAPNDTYKQALDNLHDAFNARTRDSEGAFWYWNPYPNWGVLEGLFPL
SSFISMWKTYFDPTNTTLTNTLTLSLDLFKDHCHDDSSGLLFHGYDSSKTASWADPTTGA
SPYVWNRALGDWFMTLVDLLERSGKNSAILNETQRDDVYTKYWNVANTIINDADEETGCW
WQVMLHGGEEGNYIESSGSAQFVYGLLKGARLGYLQGETPNGVAYTDAADKCYKYLLSEF
VKEEADGTLGYNGTVADCGLYDPTFEYYTTRPIEYNNLFGTSSFILASWEHEMFETGYYT

Enzyme Prediction     

No EC number prediction in ASPFODRAFT_48741-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	122	412	1e-62	0.8012048192771084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	7.50e-30	131	414	84	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	7.74e-30	137	412	97	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99486.1|GH105	0.0	1	420	1	420
BCS11787.1|GH105	0.0	1	420	1	420
CAK42095.1|GH105	6.76e-272	1	386	1	386
QRD85043.1|GH105	5.43e-115	12	412	16	416
UDD61061.1|GH105	1.75e-113	12	412	16	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.90e-44	124	412	79	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.78e-35	86	412	55	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.00e-35	86	412	45	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.95e-34	86	412	55	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.42e-22	216	407	35	224	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.42e-22	216	407	35	224	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000310	0.999680	CS pos: 25-26. Pr: 0.9483

TMHMM  Annotations     

There is no transmembrane helices in ASPFODRAFT_48741-t33_1-p1.